Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4C11G Olfactory Receptor

Gene Symbol OR4C11G
Organism Dog
Family 4
Subfamily C
Pseudo No
Location chr18:40390964-40391893 (+)
Aliases cOR4C33P, cOR4C33P

Sequence information


Nucleotide sequence

ATGCAGCAAAATAACAGTACTACTGAGTTCATACTGTTAGGATTGACCCAAGATCCTATG
AAAAAGAAAATGGTATTTGTAATATTTTTCATTTTTTATTTGGGAACTGTGGTTGGGAAT
TTGCTTATTGTTGTGACCATCAAGACCAGCCGGACACTTGGGAGCCCCATGTACTATTTC
TTATTTTATTTGTCCCTTGCTGATTCCTGCTTTTCAACTTCCACAGCCCCCAGACTAATT
GTGGATTCACTCTCTGCAAAAAATATCATAACTTACAATGAATGCATGACTCAAGTCTTT
GCACTACATTTCTTTGGTTGCATGGAGGTTTTAGTCCTTATCCTTATGGCCTTTGACCGG
TATGTGGCCATCTGTAAGCCCTTACATTACCCAACCATCATGAGCCGGCGGGTCTGCACC
ATCCTAATTGTTCTGGCATGGATTGGATCTTTTATCCATTCTATAGCCCAGATTATCCTG
GCTTTGAGGTTGCCCTTCTGTGGACCGAGTTTGATTGATCATTACTGCTGTGATTTGCAG
CCCTTGCTGAAACTTGCTTGCATGGACACTTATGTGATCAACCTACTGTTGGTGTCTAAT
AGTGGGGCCATTTGCTCAAGCAGTTTTGTGATTCTGATGATCTCCTACATTGTCATCTTG
CATTCCCTGCGAAACCACAGTGCGGAAGGGAGGAAAAAAGCTCTCTCTACTTGTACTTCT
CACATCATTGTAGTAATCATATTCTTTGGTCCCTGTATATTCATTTATACACGTCCCCCA
ACCACTTTCCCCATGGACAAGATGGTGGCCGTATTTTATACTATTGGGACACCTTTTCTC
AACCCACTCATCTACACATTGAGGAATGCAGAAGTGAAAAATGCCATGAAAAAGCTATGG
CATATCAAGATTACCTCAGAAAGCAGAAGA


Conceptual translation

MQQNNSTTEFILLGLTQDPMKKKMVFVIFFIFYLGTVVGNLLIVVTIKTSRTLGSPMYYF
LFYLSLADSCFSTSTAPRLIVDSLSAKNIITYNECMTQVFALHFFGCMEVLVLILMAFDR
YVAICKPLHYPTIMSRRVCTILIVLAWIGSFIHSIAQIILALRLPFCGPSLIDHYCCDLQ
PLLKLACMDTYVINLLLVSNSGAICSSSFVILMISYIVILHSLRNHSAEGRKKALSTCTS
HIIVVIIFFGPCIFIYTRPPTTFPMDKMVAVFYTIGTPFLNPLIYTLRNAEVKNAMKKLW
HIKITSESRR