Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4C11I Olfactory Receptor

Gene Symbol OR4C11I
Organism Dog
Family 4
Subfamily C
Pseudo No
Location chr18:***************** (+)
Aliases cOR4C37, cOR4C37

Sequence information


Nucleotide sequence

ATGCAGCAAAATAACAGCGTAACAGAGTTCATACTGTTAGGACTAACCCAAGATCCTATG
AGACAGAAAATGGTATTTGTAATCTTCTCCATTTTATATGTGGGAACTGTGGTTGGGAAT
TTGCTTATTATTGTGACCATCAAGTCTAGCCGGACACTTGGGAGCCCCATGTACTTTTTC
TTATTTTATTTGTCCCTTGCTGATTCCTGCTTTTCAACTTCCACAGCCCCCAGACTAATT
GTGGATTCACTCTCTGCAAAAAAAATCATAACTTACAATGAGTGCATGACTCAAGTCTTT
GCACTACACTTATTTGGCTCCATGGAGATCTTTGTCCTCATCCTAATGGCCTTTGACCGG
TATGTGGCCATCTGTATGCCTTTACGTTACCCAACCATCATGAGACGGCAGGTCTGCACC
ATCCTAATTGTTCTGGCATGGATTGGATCTTTTATCCATTCTACAGCCCAGATTATCCTG
GCTTTGAGATTGCCCTTCTGTGGACCCAATTTGATTGATCATTACTGCTGTGATTTGCAG
CCCTTGCTGAAACTTGCCTGCATGGACACTTATGTGATCAACCTACTGTTGGTGTCTAAT
AGTGGGGCCATTTGCTCAAGCAGTTTTGTGATTCTGATGATCTCCTACATTGTCATCTTG
CATTCCCTGCGAAACCACAGTGCAGAAGGGAAGAAAAAAGCTCTCTCTACTTGCACTTCT
CACATCATTGTAGTAATCTTATTCTTTGGTCCATGTATATTCATTTATACACGCCCGCCA
ACTACTTTCCCCATGGACAAGATGGTAACTGTATTTTATACTATTGGGACACCTTTTCTC
AATCCACTTATCTACACACTGAGGAATGCAGAAGTGAAAAATGCCATGAAAAATCTATGG
CATGTCAAAATTACCTCAGAAAGCAAAAGA


Conceptual translation

MQQNNSVTEFILLGLTQDPMRQKMVFVIFSILYVGTVVGNLLIIVTIKSSRTLGSPMYFF
LFYLSLADSCFSTSTAPRLIVDSLSAKKIITYNECMTQVFALHLFGSMEIFVLILMAFDR
YVAICMPLRYPTIMRRQVCTILIVLAWIGSFIHSTAQIILALRLPFCGPNLIDHYCCDLQ
PLLKLACMDTYVINLLLVSNSGAICSSSFVILMISYIVILHSLRNHSAEGKKKALSTCTS
HIIVVILFFGPCIFIYTRPPTTFPMDKMVTVFYTIGTPFLNPLIYTLRNAEVKNAMKNLW
HVKITSESKR