Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4C12 Olfactory Receptor

Gene Symbol OR4C12
Organism Dog
Family 4
Subfamily C
Pseudo No
Location chr18:41,208,400-41,209,300 (-)
Aliases cOR4C41

Sequence information


Nucleotide sequence

ATGGAAAATAAAAGAAATGTGACTGAATTTATTTTAATAGGTCTTACACAGAACCCCACA
ATGCAGAATATAGTATTTCTGGGATTTTTGATTCTGTACATGGTAACACTCTCAGGCAAC
TTGCTCATTGTGGTTACCATTACCACCAGCCAGGCTCTGAACTCCCCCATGTACTTCTTT
CTGACTCATCTTTCCGTGATAGACACAATTTATTCTTCCTCTTCAGCTCCTAAGCTGATT
GTGGACTCCCTTCATGAAAAGAAAATTATCTCCTTTAGTGGCTGTATGGCTCAAGTCTAT
GCAGAACACATTTTTGGTGCTACAGAGATCATCTTGCTGACAGTGATGGCCTATGATCGC
TATGTGGCCATCTGCAAACCTCTTCACTATACTACTGTCATGAACCATAGGTTGTGCATT
CTCCTGCTGGGCGTGGCCTGGACTGGAGGATTTCTCCATGCAACCATTCAGATCCTCTTC
ACAGTCTGGCTGCCCTTCTGTGGCCCTAATGTCATAGATCATTTCATGTGTGACTTGTAC
CCTTTGTTGAAACTTGTTTGCATGGACACTCATACCCTTGGTCTCTTTGTTGCTGTCAAC
AGTGGTTTCATCTGCCTTTTAAACTTCCTCCTATTGGTGGTGTCCTATGTGGTCATCCTG
TACTCCCTAAAGAACTATAGCTTGGAGGGGAGGCGCAAAGCACTTTCCACCTGTGTCTCT
CACATTACAGTGGTTGTCTTGTTCTTTGTGCCCTGCATATTTGTGTATCTGCGTCCAGTG
ACCACTCTGCCCATTGATAAAGCTGTTGCTGTCTTTTACACTATGGTGGTCCCTATGTTA
AATCCCTTAATCTACACCCTCAGAAATGTTGAGGTAAAAAATGCTATGAGGAAGCTCTGG
AGAAAAAAAGTGACTTCAGATAATGAA


Conceptual translation

MENKRNVTEFILIGLTQNPTMQNIVFLGFLILYMVTLSGNLLIVVTITTSQALNSPMYFF
LTHLSVIDTIYSSSSAPKLIVDSLHEKKIISFSGCMAQVYAEHIFGATEIILLTVMAYDR
YVAICKPLHYTTVMNHRLCILLLGVAWTGGFLHATIQILFTVWLPFCGPNVIDHFMCDLY
PLLKLVCMDTHTLGLFVAVNSGFICLLNFLLLVVSYVVILYSLKNYSLEGRRKALSTCVS
HITVVVLFFVPCIFVYLRPVTTLPIDKAVAVFYTMVVPMLNPLIYTLRNVEVKNAMRKLW
RKKVTSDNE