Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4C143P Olfactory Receptor

Gene Symbol OR4C143P
Organism Dog
Family 4
Subfamily C
Pseudo Yes
Location chr18:41266847-41267719 (-)

Sequence information


Nucleotide sequence

ATGCTGGAACTCTCACAGAACTCTGAGGTGCAGAGAGTTTTTTTGTGTGTTCTTTTTGAT
TGTCTACCTTGTCTCTATTGGAGGCAACCTACTTATCATGATCACCATTATCTTTAGTCC
CACCCTGTGCTCCCCTATGTACTTTTTCCTCTCATGCTTGTCATTCACTGATACTTGCTA
TTCCTTGTGTATGACCCCCAAACTCATCGCTGACTCCTTGTATCAGGGGAGGGCCATCTC
TTTTGAGGGCTGCCTAGTTCAATTCCTTGTTGCCCATTTATTGGGAGGAATGGAAATCAT
TCTGCTCACGGTCATGGCCTATGACCGCTATGTGGCCATCTGCAAGCCCCTGCACTACAC
GACCATCATGACCAGGCATCTCTGTGCCCTGCTGGTGGGGGTAGCTTGGTTCGGAGGCTT
CCTGCATTCCCTGGTCCAGCTCCTCCTGGTCCTTCAGCTGCCCTTCTGTGGGCCTAATGT
GATCAATCACTTTGTCTGTGACTTGTACCCCTTGCTGGAAGTCGCCTGCACCAACACGTA
TGTCATCGGCGTGCTGGTGGTCGCCAACAGTGGTGTGATCTGCCTGTTGAACTTCCTCAT
GCTGGCTGCCTCCTGTGCTGTCATCCTGCGTTCCTTGAGTTGCCATGGTGCGGAGGCGAG
TCATAAAGCCCTGTCCACCTGTGGGGCCCACTTCACTGTTGTTGCCCTGTTCTTTGTGCC
TTGTATATTTATTTATATGCGGCCTTCGTCTACTTTGTCCATAGACAAAATAGTGGCTGT
GCTTATTGTATTCTGACAACCATGTTCAACCCCCTGATTTATACACTGAGAAATGCAGAG
GTGAAAAATGCCATGAAAAATCTATGGAAAAAA


Conceptual translation

MLELSQNSE\REFFCVFFLIVYLVSIGGNLLIMITIIFSPTLCSPMYFFLSCLSFTDTC
YSLCMTPKLIADSLYQGRAISFEGCLVQFLVAHLLGGMEIILLTVMAYDRYVAICKPLHY
TTIMTRHLCALLVGVAWFGGFLHSLVQLLLVLQLPFCGPNVINHFVCDLYPLLEVACTNT
YVIGVLVVANSGVICLLNFLMLAASCAVILRSLSCHGAEASHKALSTCGAHFTVVALFFV
PCIFIYMRPSSTLSIDKIVAV/YCILTTMFNPLIYTLRNAEVKNAMKNLWKK