Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4C147P Olfactory Receptor

Gene Symbol OR4C147P
Organism Dog
Family 4
Subfamily C
Pseudo Yes
Location chr18:40251509-40252410 (+)

Sequence information


Nucleotide sequence

ATGATCATGCAGCTGAATAATATGAATAAATTTTTCTGCTTAGGTTGATCCAGGAAGAAA
GTAGTGTTTGTCACTTTTTTGCTTTTCTTCTTGGGGATGTAGTTGGGTAACTTTCTGATT
ATTACTACTTTCAAGTCCAGCCGGGCACTCGGGAGTCTGGTATACTTCTTCCTTTTCCAT
TTATCCTCATCTGACACCTGCTTCTGTACTCCCATAGCCCCTAGAATGATTATGGATGTC
CTTTTGAAGAAGACCACTGTCTCTTTCAGTAAGAACATGATACAAATTTTTTCATTCCGT
TTCTTTGGCTCCCTGGAGATCTTCATCCTCATCCTCATGACTGCTGACCACTATGTGGCC
ATCTGTAAGACCTTGCACTACACAACCATCATACGTTGACGGATCTGTGCTGTGCTGGTG
GCTATGGCCTGGGTGGGGTCCTGTGCACATTCTTTAGTTCAGACATTTCTGGCCTTGAGT
TTACCGCTCCATGGTCTCAGTGTGATTGATTGCTATCTTTGTGACTTGCAGCTTTTGTTG
AAACTTGCCTGTGCAGACACCTATGTGATCAATCTACTTCTGGTGTCCCAAAGTGGGGCC
ATTTGTACATTGAGTTTTGTCATGCTGATGTGCTCCTATGTTATATATAACCTTGCAGTC
TCTGAAAACCACAGTGCTGAGGGGAGGAGAAAAGCCCTCTCCTACATCATTGTGGTCATC
TTGTTCTTTGGTCCTTGTACATTTATATACATACATCCTGCAACCACCTTCTCTGTGATT
AAGATAATAGCTTTGTTTTATATAATTGGAATACCTTTGCTCAACCCTCTGATTTATACT
CTAAGGAATGCAGAAGTGAAAGGCATCATAGGAAATTATGGAGCAAGAAGGTGATTTCAG
AT


Conceptual translation

MIMQLNNMNKFFCLG*SRKKVVFVTFLLFFLGM*LGNFLIITTFKSSRALGSLVYFFLFH
LSSSDTCFCTPIAPRMIMDVLLKKTTVSFSKNMIQIFSFRFFGSLEIFILILMTADHYVA
ICKTLHYTTIIR*RICAVLVAMAWVGSCAHSLVQTFLALSLPLHGLSVIDCYLCDLQLLL
KLACADTYVINLLLVSQSGAICTLSFVMLMCSYVIYNLAVSENHSAEGRRKALSYIIVVI
LFFGPCTFIYIHPATTFSVIKIIALFYIIGIPLLNPLIYTLRNAEVKGI/RKLWSKKVI
SD