Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4C26P Olfactory Receptor

Gene Symbol OR4C26P
Organism Dog
Family 4
Subfamily C
Pseudo Yes
Location chrUn_JH374014:2,869-3,791 (-)
Aliases cOR4C26P

Sequence information


Nucleotide sequence

ATGGAGAATCCAAAAAATGTGACTGAATTCATACATTTGGGCATTACAGAGAACCCAGAG
CTGCGGAAAATGCTCTCTGCTGTGTTTCTAATCATGTATGTGTTCACGGTTTTGGGAAAC
CTAGTAATTGTGGTAACTGTGATCACAAGTCAAAGTCTGAGATCACCTATGTATTTTTTC
CTTACTTTCTTATCCTTTTTGGATGTTACCTACTCTTCTGTCATTGCCCCCAAGATGATT
GTGGACTCCCTCTCCAAGAGCACTGTCACCTCCTTAAAAGGTTGCATGGCGCAGCTCCTT
GCAGAGCATTTCTTTGGTGGTGTGGGGATCATCCTCTCATCGTGATGGCCTATGACCGCT
ACGTGGCCATCTGTAAGCCCCTGCACTACTCGACCATCATGAGCCCTCAGATGTGCTGCC
TGCTGCTGGGAGGGGCCTGGGTGGGGGGATTTATCCATGCAGCAATACAGCTTCTCTTCA
TGTATCAAATACCCTTCTGTGGCCCCAATGTCATTGATCATTTTATATGCGATTTGTTTC
CCTTGTTGAAACTGGCCTGCATGGACACCCATACCCTGGGTCTCCTAGTCATCCTCAACA
GTGGGGTGATGTGTATGACCATCTTCCTTATTCTCATTGCCTCCTACGTGGTCATCCTCT
GCTCTCTGAAGTCTTGCAGCTCTGAAGGGTGGCGCAAAGCCATCTCCACCTGTGGCTCCC
ACCTCACCGTGGTTGTCTTGTTCTTTGTGCCATGCATTTTCCTGTACGTGCGGCCTGTGG
CCACCTACCCCATTGACAAGGCAATGGCTGTGTCTGATTCCATCATCACACCCATGTTAA
ATCCTTTGATCTACACCCTGAGGAATTCAGAGGTGATAAATGCCATGAGGAAACTGGGGA
AACAAAGGAGTTTTGTTGGCAAG


Conceptual translation

MENPKNVTEFIHLGITENPELRKMLSAVFLIMYVFTVLGNLVIVVTVITSQSLRSPMYFF
LTFLSFLDVTYSSVIAPKMIVDSLSKSTVTSLKGCMAQLLAEHFFGGVGII/LIVMAYD
RYVAICKPLHYSTIMSPQMCCLLLGGAWVGGFIHAAIQLLFMYQIPFCGPNVIDHFICDL
FPLLKLACMDTHTLGLLVILNSGVMCMTIFLILIASYVVILCSLKSCSSEGWRKAISTCG
SHLTVVVLFFVPCIFLYVRPVATYPIDKAMAVSDSIITPMLNPLIYTLRNSEVINAMRKL
GKQRSFVGK