Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4C27 Olfactory Receptor

Gene Symbol OR4C27
Organism Dog
Family 4
Subfamily C
Pseudo No
Location chr18:41010787-41011698 (-)
Aliases cOR4C27, cOR4C27

Sequence information


Nucleotide sequence

ATGGAGTTGAATAGCAGTGTGAATGAGTTCATTCTGTTTGGGTTAACACAGGATGTTTTA
AAGGAGAAAGTCGTACTTGTGGTCTTTGTGTTTCTATACCTTGCAACTCTGTTGGCAAAT
TTACTGATTGTTATAACCATAAGATACAGCCAGACACTTGGGAGCCCCATGTACTTCTTC
CTTTTCTACTTATCCTTTGCTGATGCCTGCTTCTCAACAACCACTGCTCCTAGGTTGATA
GTAGATTCTGTATCTAAGAAGAAAGTTATCTCCTACAATGAGTGCATGACTCAGATTTTT
GCATTTCACTTCTTTGGGTGCATGGAGATCTTGGTGCTTGTCCTCATGTCCTTGGATCGC
TATGTGGCCATTTGTAAGCCTCTGAGGTATACAACTATCATGAGCCGGCGTGTCTGTGGT
ACACTGGTGAATCTAGCCTGGGTGGTGTCTTGTATCCATTCTTCTGCACAGATTTTCCTG
GCTTTGAAGTTACCATTCTGTGGACCTAATGTTATTGATCATTATTTCTGTGATATGCCA
CCTTTGTTGAAGCTTGCATGCATGGACACTCATGCAACCAATTTACTCATAGTTTTTAAT
AGCGGGGCTATCTGCACAGTAAGTTTCATGGTCCTGCTTACCTCTTATATTTTCATCTTA
CATTCTTTGAATAACCAGAGTGCAGAAGGAAGAAAGAAAGCCCTCTCTACCTGCACATCC
CACATTATTGTTGTCATCTTATTTTTTGTTCCGTGTATATTCACATATACTCGCCCTGTA
ACTTCATTTCCAGCGGACAAGATGGTGGCTGTGTTTTACACTATTGTGACACCCTTGCTC
AATCCTCTAATTTACACGCTGAGAAATGCAGAAGTGAAAAATGCCATGAGGAAGCTATGG
TGCAACAAACTC


Conceptual translation

MELNSSVNEFILFGLTQDVLKEKVVLVVFVFLYLATLLANLLIVITIRYSQTLGSPMYFF
LFYLSFADACFSTTTAPRLIVDSVSKKKVISYNECMTQIFAFHFFGCMEILVLVLMSLDR
YVAICKPLRYTTIMSRRVCGTLVNLAWVVSCIHSSAQIFLALKLPFCGPNVIDHYFCDMP
PLLKLACMDTHATNLLIVFNSGAICTVSFMVLLTSYIFILHSLNNQSAEGRKKALSTCTS
HIIVVILFFVPCIFTYTRPVTSFPADKMVAVFYTIVTPLLNPLIYTLRNAEVKNAMRKLW
CNKL