Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4C28 Olfactory Receptor

Gene Symbol OR4C28
Organism Dog
Family 4
Subfamily C
Pseudo No
Location chr18:40885064-40885975 (-)
Aliases cOR4C28P, cOR4C28P

Sequence information


Nucleotide sequence

ATGTCAATGAACAGCAGTGTGAATGAATTCATTTTGCTTGGCTTGACACAGGATCCAAGA
AAACAGAAAGCAATATTTGGGGTCTTCTTGATGTTTTACCTTGCCACACTGTTGGGAAAC
TTTCTCATTGTAGTGACTATTAAAAGAAGCAGGACCCTTGGGAGTCCCATGTACTTCTTC
CTATTTTACCTGTCCTTTGCTGATGCCTGCTTTTCTACAACCATTGCCCCCAGGTTGATT
GTGGATGCCATTTCCCAGCAGAAGACTATTTCCTACAATGAGTGCATGACTCAGGTCTTT
GCAGTCCACTTCTTTGCTTGCATGGGAATCTTCGTGCTGATCCTCATGGCTTTTGATCGC
TATGTAGCTATTTGTAAGCCCTTGCGATACACAACCATCATGAACAGGCATGTCTGCAGT
GTGCTGGTGACTCTGGGTTGGGTGGGATCCTGTATCCACTCTTCAGCACAAATTGTCCTG
GCTTTGAAATTGCCTTTCTGTGGTCCCAATATGATTGATCACTATTTCTGTGACTTGCAG
CCCTTGTTGAAACTTGCTTGCATGGACACTTATGTAATAAATTTGCTAGTTGTTACTAAC
AGTGGAGCCATATGCATGGTGAGTTTCATAATCTTGCTTATCTCCTATGTTATCATCTTG
TACTCTCTGAGAAACTACAGTGCAGAAGGAAGGCGAAAAGCCCTTTCAACCTGCACTTCC
CATTTTATTGTGGTTGTCTTATGTTTTGGCCCATGTATATTCATTTATACACGTCCAGCA
ACCACATTTCCAGTAGACAAGGTGGTGGCAGTGTTTTATACCATTGGGACACCCTTGCTG
AACCCTCTGATCTACACACTGAGGAATGCAGAAGTGAAAATTGCAATGAAAATGTTATGG
TGTAGCAAAGTA


Conceptual translation

MSMNSSVNEFILLGLTQDPRKQKAIFGVFLMFYLATLLGNFLIVVTIKRSRTLGSPMYFF
LFYLSFADACFSTTIAPRLIVDAISQQKTISYNECMTQVFAVHFFACMGIFVLILMAFDR
YVAICKPLRYTTIMNRHVCSVLVTLGWVGSCIHSSAQIVLALKLPFCGPNMIDHYFCDLQ
PLLKLACMDTYVINLLVVTNSGAICMVSFIILLISYVIILYSLRNYSAEGRRKALSTCTS
HFIVVVLCFGPCIFIYTRPATTFPVDKVVAVFYTIGTPLLNPLIYTLRNAEVKIAMKMLW
CSKV