Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4C29 Olfactory Receptor

Gene Symbol OR4C29
Organism Dog
Family 4
Subfamily C
Pseudo No
Location chr18:40,808,900-40,809,800 (-)
Aliases cOR4C29

Sequence information


Nucleotide sequence

ATGCACCTGAATAATAATGTGACTGAGTTCATTCTGCTTGGATTGACCCAGGATCCTGTT
AGAAAAAAAATAGTGTTTGTCACTTTTTTGTTTTTCTATTTGGGGACATTGCTGGGTAAC
TTTCTGATTATTACTACTATCAAGACCAGCCAGACACTAGGGAGTCCAATGTACTTCTTC
CTTTTCCACCTATCCTTGTCTGACACCTGCTTCTGTACTTCCATAGCCCCTAGAATGATT
GTTGATGCACTTTTGAAAAGGGCCACAATCTCTTTCAGGGAGTGCATGATACAAGTCTTT
TCATTCCACTTCTTTGGCTGCCTGGAGATCTTCATCCTTATCCTCATGGCTGCTGACCGC
TATGTGGCCATCTGTAAGCCCCTGCACTACACAACCATCATGAGTCGACAGGTCTGTGCT
GTGCTGGTGGCTATTGCCTGGGTGGGGTCCTGTGTGCATTCTTTAGCTCAGATTTTTCTG
GCCCTGAGTTTACCTTTCTGTGGTCCCAATGTGATCGATCACTATCTTTGTGACTTGCAG
CCCTTGTTGAAACTTGCCTGTGCAGATACCTATGTGATCAATCTACTGTTGATATCCAAT
AGTGGGGCCATTTGTACACTGAGTTTTGTCATGCTGATGTGCTCCTATGTTGTCATCTTG
TATTCTCTGAGAAATCACAGTGCTGAAGGGAGGAGGAAAGCCCTCTCCACCTGCATCTCC
CACATCATTGTAGTCGTCTTGTTCTTTGGTCCTTGCATATTTATATACACACGCCCTGCA
ACCACCTTTCCCATGGATAAGATGATAGCTGTATTTTATACACTTGGAACACCTTTGATC
AATCCTCTGATTTACACACTTAGGAATGCAGAAGTGAAAAATGCCATGAAGAAGTTATGG
AGGAAGAAGTTGATTTCAGATGACAAAAGA


Conceptual translation

MHLNNNVTEFILLGLTQDPVRKKIVFVTFLFFYLGTLLGNFLIITTIKTSQTLGSPMYFF
LFHLSLSDTCFCTSIAPRMIVDALLKRATISFRECMIQVFSFHFFGCLEIFILILMAADR
YVAICKPLHYTTIMSRQVCAVLVAIAWVGSCVHSLAQIFLALSLPFCGPNVIDHYLCDLQ
PLLKLACADTYVINLLLISNSGAICTLSFVMLMCSYVVILYSLRNHSAEGRRKALSTCIS
HIIVVVLFFGPCIFIYTRPATTFPMDKMIAVFYTLGTPLINPLIYTLRNAEVKNAMKKLW
RKKLISDDKR