Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4C32 Olfactory Receptor

Gene Symbol OR4C32
Organism Dog
Family 4
Subfamily C
Pseudo No
Location chr18:***************** (-)
Aliases cOR4C32P, cOR4C32P

Sequence information


Nucleotide sequence

ATGGCGATGAACAGCAGTGTGAATGAATTCATTCTGTTTGGCTTGACACAGGATCCAAGA
AAACAGAAAGCAATATTTGGGGTCTTCTTGATGTTTTACCTTGCCACACTGTTGGGAAAC
TTTCTCATTGTAGTGACTATTAAAAGAAGCAGGACCCTTGGGAGTCCCATGTACTTCTTC
CTATTTTACCTGTCCTTTGCTGATGCCTGCTTCTCTACAACCACAGCTCCCAGGTTGATT
GTGGATGCCATTTCCCAGCAGAAGACTATTTCCTACAATGAGTGCATGACTCAGGTCTTT
TCAGCCCATTTCTTTGGATGCATGGAAATCTTCGTGCTGATCCTGATGGCTTTTGATCGC
TATGTAGCCATTTGTAAGCCCTTGCGTTACACAACCATCCTGAACAGGCATGTCTGCAGT
GTACTGGTGATTCTGGGTTGGGTGGGATCCTGTATCCACTCTTCGGCACAAATTGTCCTG
GCTTTGAGATTGCCTTTCTGTGGTCCCAATGTGATTGATCACTATTTCTGTGACTTGCAG
CCCTTGCTGAAACTTGCTTGCATGGACACTTATGTAATAAATTTGCTAGTTGTTTCTAAC
AGTGGAGCCATATGCACGGTGAGTTTCATAATCCTGCTTATCTCCTATGTTATCATCTTG
TACTCTCTGAGAAACTACAGTGCAGAAGGAAAGCGAAAAGCCCTTTCGACCTGCACCTCC
CATTTTATTGTGGTTGTCCTATTTTTTGGTCCATGTATATTCATGTATACACGCCCAGCA
ACCACATTTCCAGTAGACAAGGTGGTGGCAGTGTTTTATACCATTGGGGCACCCTTGCTG
AACCCTCTGATCTATACACTGAGGAATGCGGAAGTGAAAAATGCCATGAAAAAGTTATGG
TGTAGCAAATTG


Conceptual translation

MAMNSSVNEFILFGLTQDPRKQKAIFGVFLMFYLATLLGNFLIVVTIKRSRTLGSPMYFF
LFYLSFADACFSTTTAPRLIVDAISQQKTISYNECMTQVFSAHFFGCMEIFVLILMAFDR
YVAICKPLRYTTILNRHVCSVLVILGWVGSCIHSSAQIVLALRLPFCGPNVIDHYFCDLQ
PLLKLACMDTYVINLLVVSNSGAICTVSFIILLISYVIILYSLRNYSAEGKRKALSTCTS
HFIVVVLFFGPCIFMYTRPATTFPVDKVVAVFYTIGAPLLNPLIYTLRNAEVKNAMKKLW
CSKL