Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4C45 Olfactory Receptor

Gene Symbol OR4C45
Organism Dog
Family 4
Subfamily C
Pseudo No
Location chr18:41,241,100-41,242,000 (+)
Aliases cOR4C52

Sequence information


Nucleotide sequence

ATGGACCATGTGCTCATAACCCAAGCTGACTCCATGGAAAGGATGAACAATGTAACAGAA
TTTGTTCTGCTGGGCCTGACCCAGAATCCAGAACTGCAGAAATTCTTATTTGCTGTATTT
TTAATCACCTACTTGATCACACTGGCAGGTAACCTACTCATCTCGGTCACCATCTTCATC
AGCCCAGCTCTGGGTTCTCCCATGTACTTTTTTCTATCCTATTTGTCCATCATAGATGGC
TTCTACTCTTCTTCCATAGCACCTAAAATGATCTTTGACTTAATCTCTGAGCGGAACACC
ATATCCTTCAATGGCTGCATGACTCAACTCTTTGCTGAACATTTCTTTGCTGGTGCTGAG
ATCATTTTATTAATTGCCATGGCTTATGACCGCTATGTAGCCATCTGTAAGCCATTGCAT
TACATGACCATTATGAGCCGACCTGTCTGTGGTTTCTTGGTAGGAATGGCTGGAATTTTG
GGCTTTGTTCATGGAGGGATCCAGGTTTTGTTCATGATCCAGTTACCATTCTGTGGCCCC
AATGTTATTGACCATTTTATGTGTGATTTAATACCTCTCCTGGAGCTAACGTGTGCAGAC
ACTCACACTTTGGGGCCCCTGGTTTCTGCCAACAGTGGATCACTATGTTTGCTCACTTTT
TCTATGCTGGTTGCTTCTTACATTGTCATCCTGCGCTCCCTGAGGACTCATAGCTCTGAA
GGGCGTCGCAAAGCCCTGTCTACCTGTGCTTCTCATGTCACTGTTGTCATCTTATTCTTT
GTACCTTGTTCATTCCTGTACCTGAGACCCACGACCTCCTTCCCTGCTGACAAAGCTGTG
ACTGTGTTTTGTACCCTAGTAACTCCTATGTTGAATCCTTTAATCTATACCCTCAGAAAT
TCAGAAGTAAAAAATGTCATGAAGAAACTCTGGGGACAAATAATGAAAACTGGTGATAAA


Conceptual translation

MDHVLITQADSMERMNNVTEFVLLGLTQNPELQKFLFAVFLITYLITLAGNLLISVTIFI
SPALGSPMYFFLSYLSIIDGFYSSSIAPKMIFDLISERNTISFNGCMTQLFAEHFFAGAE
IILLIAMAYDRYVAICKPLHYMTIMSRPVCGFLVGMAGILGFVHGGIQVLFMIQLPFCGP
NVIDHFMCDLIPLLELTCADTHTLGPLVSANSGSLCLLTFSMLVASYIVILRSLRTHSSE
GRRKALSTCASHVTVVILFFVPCSFLYLRPTTSFPADKAVTVFCTLVTPMLNPLIYTLRN
SEVKNVMKKLWGQIMKTGDK