Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4C49P Olfactory Receptor

Gene Symbol OR4C49P
Organism Dog
Family 4
Subfamily C
Pseudo Yes
Location chr23:50889156-50889713 (+)

Sequence information


Nucleotide sequence

TTAAAGAAAATTATATTTGTTCTAGTTTCCAACATCTACATCATTTCTGTGGTAGGAAAT
GTGCTCATTGTGGCCACCATCACTGCCAGCCCGTCATGGAGGCCTCCCATGTACCTTTTC
CTGGCCTATCTCTTCTTTACTGATGGTTGCTGTTCTTCTATAAATATTCCTAAACTGATT
ATAGATTTACTCTATGAAAGACCATCCTATTGAATGAGTATATGACCTGAATCTTTGGAG
AACATTTCTTTGGAGCTGCTGACACCATCCTACCTAGTGTGATGGCCTCTGTTATGTGGC
CATCTGCAAGCCGTTGCGTTATACAACCATCATGCACTGGCGGATGTGTGGCCTGCTAGT
TGGAGTGGTGTGGGTGGGAGGCTTTCTTCATGCAACCACATAGATCCTCTTCAGTTCTGG
TTATCCTTCTATAACCCTAACATCACAGATCACTCTATGTGTAATTTGAACCCTTTGCTC
AATCTTGCCCGCACAGATACCCAACTCTTTGTTGCAGCCAACAGTGGATTGATCTATGTG
CTAAACTTCCTTTTCTTT


Conceptual translation

LKKIIFVLVSNIYIISVVGNVLIVATITASPSWRPPMYLFLAYLFFTDGCCSSINIPKLI
IDLLY/KTILLNEYMT*IFGEHFFGAADTILPSVMAS/YVAICKPLRYTTIMHWRMCG
LLVGVVWVGGFLHATT*ILFS/WLSFYNPNITDHSMCNLNPLLNLARTDTQLFVAANSG
LIYVLNFLFF