Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4C59 Olfactory Receptor

Gene Symbol OR4C59
Organism Dog
Family 4
Subfamily C
Pseudo No
Location chr18:41,031,300-41,032,300 (-)
Aliases cOR4C59

Sequence information


Nucleotide sequence

ATGGAGAATCCAAGAAATGTGACTGAATTCATTCTTTTGGGCATTACAGAGAACCCAGAG
CTGCGGAAAATGCTCTCTGCTGTGTTTCTAATCATGTATGTGTCCACGGTTTTGGGAAAC
CTAGTAATTGTGGTAACTGTGATCACAAGTCAGAGTCTGAGATCACCTATGTATTTTTTC
CTTCCTTTCTTATCCCTTTTGGATGTTACCTACTCTTCTGTCATTGCTCCCAAGATGATT
GTGGACTCCCTCTCCAAGAGCACTGCCATCTCCTTAGAAGGTTGCATGACCCAGCTCTTT
GCAGAGCATTTCTTTGGTGGTGTGGGGATCATCCTTCTCATCGTGATGGCCTATGACCGC
TATGTGGCCATCTGTAAGCCCCTGCACTACATGACCATCATGAGCCCTCGGATGTGCTGC
CTGCTGCTGGGAGGGGCCTGGGTGGGGGGGTTTATCCATGCAGCAATACAGCTTCTCTTC
ATGTATCAACTACCCTTCTGTGGCCTCAATGTTATTGATCACTTTATGTGTGATTTGTTT
CCCTTGTTGAAACTGGCCTGCATGGACACCCACACCCTGGGTATCCTAGTCATCCTCAAC
AGTGGGGTGATGTGTATGACCATCTTCCTTATCCTCATCACCTCCTACATGGTCATCCTC
TGCTCTCTGAAGTCTTGCAGCTCTGAAGGGCGGCGCAAAGCCTTCTCCACCTGTGGCTCC
CACCTCACCGTGGTTGTCTTGTTCTTTGTGCCATGCATTTTCCTATATGTGCGGCCTGTG
GCCACGTACCCCATTGACAAGGCAATGGCTGTGTCTTTTACCATTGTTACACCCATGTTA
AATCCCTTGATCTACACCCTGAGGAATTCAGAGGTGAAAAATGCCGTGAGGAAACTGGTG
AAACAAGGGATCCTGGGCATCACTAGCTCACATGCTAAGGAC


Conceptual translation

MENPRNVTEFILLGITENPELRKMLSAVFLIMYVSTVLGNLVIVVTVITSQSLRSPMYFF
LPFLSLLDVTYSSVIAPKMIVDSLSKSTAISLEGCMTQLFAEHFFGGVGIILLIVMAYDR
YVAICKPLHYMTIMSPRMCCLLLGGAWVGGFIHAAIQLLFMYQLPFCGLNVIDHFMCDLF
PLLKLACMDTHTLGILVILNSGVMCMTIFLILITSYMVILCSLKSCSSEGRRKAFSTCGS
HLTVVVLFFVPCIFLYVRPVATYPIDKAMAVSFTIVTPMLNPLIYTLRNSEVKNAVRKLV
KQGILGITSSHAKD