Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4C62P Olfactory Receptor

Gene Symbol OR4C62P
Organism Dog
Family 4
Subfamily C
Pseudo Yes
Location chr18:40373281-40374208 (+)

Sequence information


Nucleotide sequence

ATGGAGACTAGGAACAATGTGACAGAATTTGTGCTACTGGGGCTCACAGAGAATCCAAAG
ATGCAGAAAATCATATTAGTTGTGTTTCTGGTCATCTACATCGTTTCTATGGTAGGAAAT
GTGCTCACGTGGTCACTATCACTGCCAGCCCATTATCGGGGTCCCCCATGTACTTTTTTC
TGGCCTATCTCTCCCTCATTGATGCCTGCTATTCTTTTGTCAATACCCCTACACTCATCA
TAGAGTCACTCCGTGAAAAGAAGACCATCCCATTCAATGCATGCATAATCCAAATCTTTG
GGGAACATTTTTTGGAGGTGCTGATGTCATCCTGCTTACTGTGATGGCCTATGACAGCTA
TGTAGCTATCTGCAAGCCACTGCACTACATGACCATCATGAATTAGCAGGTATGTGGCCT
GCTCATGGCAGTGGAGTGGGTGGGAGGCTTTCCTCATGCAGCCATACAGATCTTCTTTAT
CATCCCACTACCCTTCTGTGGCCCTAATGTCATAGATCACTTTATATGTGATCTGAATCC
TTTGCTCAATCTTGCCTGCACTGATACCCACACTCTCAGATTCTTTGTTGCTGCCAACAG
TGGTTTCATCTGTGTCTTAAACCTCCTCCTCCTCCTCATGGTCTCCTATGTGGTCATTCT
GCACTCCTTAAGGAACCACAGCTTTGAGGCAAGGTGCAAAGCCCTCTCCATCTGTGTCTC
CTACATCACAGTGGTCATCCTATACTTTGTGCCCTGCATATTTGTATACATGAGACCCGC
AGCTACTTTATCAATTGATAAAGCTATTACAGTGTTCTATACTACAATAACTCCCATGTT
AAATCCTTTAATCTATACCTTGAGAAATGACCAGATGAAAAATGCCATTAGGAAACTGTG
TAGTAGGAATGCTAGTGTGGGTGACAAA


Conceptual translation

METRNNVTEFVLLGLTENPKMQKIILVVFLVIYIVSMVGNVL/VVTITASPLSGSPMYF
FLAYLSLIDACYSFVNTPTLIIESLREKKTIPFNACIIQIFGEH/FGGADVILLTVMAY
DSYVAICKPLHYMTIMN*QVCGLLMAVEWVGGFPHAAIQIFFIIPLPFCGPNVIDHFICD
LNPLLNLACTDTHTLRFFVAANSGFICVLNLLLLLMVSYVVILHSLRNHSFEARCKALSI
CVSYITVVILYFVPCIFVYMRPAATLSIDKAITVFYTTITPMLNPLIYTLRNDQMKNAIR
KLCSRNASVGDK