Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4D5 Olfactory Receptor

Gene Symbol OR4D5
Organism Dog
Family 4
Subfamily D
Pseudo No
Location chr5:10546268-10547329 (-)
Aliases cOR4D5

Sequence information


Nucleotide sequence

ATGAGATGGGGAGAATTTCCCAGACAGGGTAGGGGAAATTATTGCAGAGAAGCTGATGGA
TCCCATGATGAATATGTCCGCTTTCCTCAGCAGGTTCACTTACCAGGTCATATCAAGCAG
ATGAATCCAACAAATCATACCCAGGTGACAGGCTTTGTCCTCCTGGGGCTCTCTCAGGTA
TGGGAGCTCCGGTTCTTCTTCTTCATTGTCTTCTCAGCTGTGTATCTTATGACTGTAATG
GGAAATCTCCTTATTGTGGCCATAGTGACCTCTGACCCACGCCTCCACACAACCATGTAT
TTTCTCTTAGGCAATCTTTCTTTCCTAGACTTTTGCTACTCTACCATCACGGCACCCAGG
ATGCTGGTTGACTTGCTCTCAGGCAACCCCATCATTTCCTTTGGTAGCTGCCTGACTCAG
CTCTTTTTCTTCCATTTCATTGGAGGCATCAAGATCTTCCTGCTGACTGTGATGGCGTTT
GACCGCTATATTGCCATCTCCCAGCCCTTGCGCTACAGGATTATTATGAATAGAACAGTC
TGTGGGCTCCTCGTGGTAGCCTCCTGGGTGGGGGGCTTCATCCACTCCATTGTACAGGTT
GGACTGACTATCCAGCTGCCATTCTGTGGGCCTGACAGGCTGGACAACTTTTACTGTGAT
GTGCCTCAGCTGATCAAATTGGCCTGCACAGATACCTTTGTCTTAGAGCTTCTGATGGTG
TCTAACAATGGCCTGGTGACCCTGATGTGTTTTCTGGTGCTCCTGGGATCCTACACGGCA
CTGCTGGTCATGCTCCGAGGCCACTCCAGGGAGGGCCGCAGCAAAGCCCTATCCACTTGT
GCTTCTCATATTGCCGTAGTGACCTTAATCTTTGTGCCTTGTGTCTACATCTATGCAAGG
CCATTTCGCACCTTCCCTATGGACAAGGTGGTCTCTGTGCTGTACACAATGGTCACTCCC
ATGCTGAATCCTGCCATCTATACCCTGAGAAACAAGGAAGCGATCATGGCCATGAAGAAG
CTGTGGAGAAGGCAAAAAGACCTTCTGGGTCCCCTGGAGCAC


Conceptual translation

MRWGEFPRQGRGNYCREADGSHDEYVRFPQQVHLPGHIKQMNPTNHTQVTGFVLLGLSQV
WELRFFFFIVFSAVYLMTVMGNLLIVAIVTSDPRLHTTMYFLLGNLSFLDFCYSTITAPR
MLVDLLSGNPIISFGSCLTQLFFFHFIGGIKIFLLTVMAFDRYIAISQPLRYRIIMNRTV
CGLLVVASWVGGFIHSIVQVGLTIQLPFCGPDRLDNFYCDVPQLIKLACTDTFVLELLMV
SNNGLVTLMCFLVLLGSYTALLVMLRGHSREGRSKALSTCASHIAVVTLIFVPCVYIYAR
PFRTFPMDKVVSVLYTMVTPMLNPAIYTLRNKEAIMAMKKLWRRQKDLLGPLEH