Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4D9 Olfactory Receptor

Gene Symbol OR4D9
Organism Dog
Family 4
Subfamily D
Pseudo No
Location chr18:37225147-37226079 (-)
Aliases cOR4Z2, cOR4Z2

Sequence information


Nucleotide sequence

ATGGATCAGGGAAATTATACGAAAGTGAAAGAATTTCTTTTCCTGGGTATTACTCAGTCT
CGAGAGCTGAGCTTGGTCTTGTTTGTCTTCTTGTTTACGGTGTATATGACAACTCTGCTG
GGAAACCTCCTCATCATGGTCACTGTGACCTTTGAGTCTCACCTTCATACCCCCATGTAC
TTCCTGCTCCGCAACCTCTCTGTCTTGGACATCTGCTTCTCCTCCATCACTGCTCCCAAG
GTCCTAGTTGATCTTCTATCAAAAAGAAAAACCATCTCCTTCAATGGCTGTGTCACTCAA
ATGTTTTTCTTCCACCTTCTGGGAGGAGCAGATGTTTTTTCTCTCTCTGTGATGGCCTTT
GATCGCTACGTGGCCATCTCAAGACCCCTTCACTATATGACAATCATGAGTAAGGAACGA
TGTACTAGCCTGGTGCTGGCCTCCTGGGTGGGGGGCTTTGTCCACTCCATCGTGCAGATT
TCCCTGTTGCTTCCACTCCCCTTCTGTGGACCCAATGTTCTTGACACTTTCTACTGCGAT
GTCCCCCAGGTCCTCAAGCTCGCCTGTACAGACACCATCTCTCTGGAGATCCTGATGATT
TCTAATAATGGATTAGTCAGTTGGCTTATTTTCTTCTTTCTCCTCATATCTTACACGGTC
ATTCTGATGATGCTGAGGTCTCATGCTGGGGAGGGAAGGAGGAAAGCCATCTCCACCTGC
ACCTCCCACATCACTGTGGTAACCTTACACTTTGTGCCCTGTATCTATGTCTATGCCCGG
CCCTTTACTGCCCTCCCCACAGATAAAGCCATCTCTGTCACCTTCACGGTCATCTCCCCT
TTGCTCAATCCTATGATCTACACCCTGAGGAACCAGGAAATGAAGTCAGCCATGAGGAGA
TTAAAGAAACGACTAGGGCATTCAGAAAGGATT


Conceptual translation

MDQGNYTKVKEFLFLGITQSRELSLVLFVFLFTVYMTTLLGNLLIMVTVTFESHLHTPMY
FLLRNLSVLDICFSSITAPKVLVDLLSKRKTISFNGCVTQMFFFHLLGGADVFSLSVMAF
DRYVAISRPLHYMTIMSKERCTSLVLASWVGGFVHSIVQISLLLPLPFCGPNVLDTFYCD
VPQVLKLACTDTISLEILMISNNGLVSWLIFFFLLISYTVILMMLRSHAGEGRRKAISTC
TSHITVVTLHFVPCIYVYARPFTALPTDKAISVTFTVISPLLNPMIYTLRNQEMKSAMRR
LKKRLGHSERI