Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4D9B Olfactory Receptor

Gene Symbol OR4D9B
Organism Dog
Family 4
Subfamily D
Pseudo No
Location chr18:37266589-37267581 (-)
Aliases cOR4Z4P, cOR4Z4P

Sequence information


Nucleotide sequence

ATGCCTCAGCACTATTATTGTTTCTTTCAAAGCTGTACATGGAGGAAGAAATACCATCCA
ATGGCCCTGAGAAATCATTCCAAGGTGTCTAAATTTATTTTTTGTGGACTTACCCAGTCT
CAAGAGCTGAGCTTGCTCTTATTTTTCTTTCTATCTGTAGTTTATGTGACAACAGTGTTA
GCAAATGTTGCCATCATGGTGACTGTGACCTGTGAGTCCCGACTTCATACCCCCATGTAC
TTCCTGCTCCGCAACCTCTCGGTCTTGGACATCTGCTTCTCCTCCATCACTGCTCCCAAG
GTCCTTGTGGACCTTCTGTCAAGAACAAAGACCATCTCCTTCAATGGTTGCATCACTCAG
ATGTTCTTCTTCCACCTTCTCGGTGGGGCAGACATTTTTTCTCTCTCTGTGATGGCCTTT
GACCGCTACATGGCCATCTCCAAGCCCTTGCACTACGTGACCATCATGAGTAGGGGGCGA
TGCACTGCCCTCATTGTGGCCTCCTGGGTGGGGGGCTTTGTTCACTCCATCGTGCAGATT
TCCCTGTTGCTGCCCCTCCCCTTCTGTGGGCCTAATGTTGTTGATGGCTTCTACTGCGAT
GTCCCCCAGGTCCTCAAACTTGCCTGCACTGACACCTTTGTTCTTGAAGTCTTAATGATT
TCCAACAATGGTCTGGTCACTACCCTGTGGTTTGTCCTTCTTCTTGTGTCCTACACAGTC
ATCTTGATGATGCTGAGGTCTCACACTGGGGAAGGCAGGAGGAAAGCCATCTCTACCTGC
ACAGCCCACATCACTGTGGTGACCCTTCACTTTGTGCCCTGCATCTATGTCTATGCCCGG
CCCTTCACTGCCCTTCCCATGGACAGAGCCGTCTCCATCACCTTCACAGTCATCATCCCG
GTTCTGAACCCCATGATCTACACCCTGAGGAACCAGGAGATGAAGTCAGCCATGAGGAGA
CTGAAGAGAAGACTTATGTTTTCTGAAAGGACA


Conceptual translation

MPQHYYCFFQSCTWRKKYHPMALRNHSKVSKFIFCGLTQSQELSLLLFFFLSVVYVTTVL
ANVAIMVTVTCESRLHTPMYFLLRNLSVLDICFSSITAPKVLVDLLSRTKTISFNGCITQ
MFFFHLLGGADIFSLSVMAFDRYMAISKPLHYVTIMSRGRCTALIVASWVGGFVHSIVQI
SLLLPLPFCGPNVVDGFYCDVPQVLKLACTDTFVLEVLMISNNGLVTTLWFVLLLVSYTV
ILMMLRSHTGEGRRKAISTCTAHITVVTLHFVPCIYVYARPFTALPMDRAVSITFTVIIP
VLNPMIYTLRNQEMKSAMRRLKRRLMFSERT