Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4E2 Olfactory Receptor

Gene Symbol OR4E2
Organism Dog
Family 4
Subfamily E
Pseudo No
Location chr15:18641193-18642116 (+)
Aliases cOR4E3

Sequence information


Nucleotide sequence

ATGGAGGCTCCGAATCAAACAAGAGTGACTGAGTTTGTCTTCTTGGGGCTCACAGATAAC
TGGGCGCTGGGGACGCTACTTTTTGTGGCATTCTCCCTGGCTTATGTGCTCACCCTTCTG
GGGAACACTCTCATCATAGTGACCACGGCCCTTACCCGGCGCCTCCATACCCCCATGTAC
TTCTTCCTGAGCAACCTGTCCTTCATTGACACCTGCCACTCCTCGGTCACTGTGCCCAAG
ATGCTGGAGGGCCTGCTTAGGGAGAGAAAGACTATTTCCTTTGATGACTGCATTGCGCAG
CTCTTCTTCCTACACCTGTTCGCTTGTGCTGAGATCCTTCTGCTGACCGTCATGGCTTAC
GACCGCTACGTGGCCATCTGTGCCCCGCTGCGCTACCCCAACGTGATGAGCATCCGGGTG
TGTGTGCAGCTCGTCCTCGCCCTCTGGTGGGGGGGTACCGTTCACTCTCTGGTGCAGACC
CTCCTGACCATTCGTTTGCCCTACTGCGGCCCCAACGTTATCGATAGCTACTTCTGCGAT
GTGCCCCCCGTCATCAAGCTGGCCTGCACGGACACCTACCTCACGGGAGTGCTCATTGTC
TCCAACAGTGGAACCATCTCCCTCACCTGTTTCCTGGCTTTGGTCACCTCTTACACAATC
ATCCTGGTGTCTCTTAGAAAACAGTCTGCTGAAGGGCGCCGGAAAGCTCTGTCTACGTGC
TCAGCCCACTTCATGGTGGTCGCCTTCTTCTTTGGACCATGCATCTTCATCTACACTCGG
CCAGACACCAGCTTCTCCATCGACAAGGTGGTATCTGTCTTCTACACCGTGGTCACCCCT
TTGCTAAATCCCCTCATTTACACCTTGAGGAATGAGGAGGTAAAAAGTGCCATAAAGCAT
CTCAGACAGAAACAGGTTTTCTCA


Conceptual translation

MEAPNQTRVTEFVFLGLTDNWALGTLLFVAFSLAYVLTLLGNTLIIVTTALTRRLHTPMY
FFLSNLSFIDTCHSSVTVPKMLEGLLRERKTISFDDCIAQLFFLHLFACAEILLLTVMAY
DRYVAICAPLRYPNVMSIRVCVQLVLALWWGGTVHSLVQTLLTIRLPYCGPNVIDSYFCD
VPPVIKLACTDTYLTGVLIVSNSGTISLTCFLALVTSYTIILVSLRKQSAEGRRKALSTC
SAHFMVVAFFFGPCIFIYTRPDTSFSIDKVVSVFYTVVTPLLNPLIYTLRNEEVKSAIKH
LRQKQVFS