Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4F1BP Olfactory Receptor

Gene Symbol OR4F1BP
Organism Dog
Family 4
Subfamily F
Pseudo Yes
Location chr30:236212-237145 (+)

Sequence information


Nucleotide sequence

ATGGATGGAGGGAATCACTCGGCTGTGTCTGAGTTTGTGTTCCTGGGACTCACTCACTCA
TGGGAGATCCAGCTTCTCCTTCTGGTGTTCTCCTCTGTGCTCTACGTGGCAAGCATGACT
GGAAACATCCTCATTGTGTTTTCTGTGACCATTGATCCTCACTTACACTCCCCCATGTAC
TTTCTCCTGGCCAGTCTCTCTTTCACTGACTTGGGAGCCTGCTCTGCTACCTCACCCAAG
ATGATTTATGACCTTTTCAGAAAGCACAAAGTCATCCCCTTTGGCGGCTGCATCGCCCAG
ATCTTCTTCATCCATGTCATTGGTGGCGTGGAATGGTGCTGCTCATTGCCATGGCCTTTG
ACAGATATGTGGCCACATGCAAGCCCCTCCACTATCTGACCATCATGAGCCCACAGAGGT
GCATCTTATTTCTGGCTGCTGCTTGGGCCCTTGGTGTCAGTCACTCACTGTTCCAACTGG
CATTTGTTGTTAATCTACCCTTCTGTGGTCCTAATGTGCTGGACAGCTTTTACTGTGACC
TTCCTCGTCTCCTCAGACTGGCCTGTACAGACACCTACAGGTTGCAGTTCATGGTCACTG
TCAACAGTGGGTTTATCTGTGTTGGTTCCTTCTTCATACTCCTCATCTCCTACGTCTTCA
TCCTGTTTACTGTTTGGAAACATTCCTCAGGTGGCTCATCCAAGGCCCTCTCCACTTTGT
CAGCTCACATCACTGTGGTATTTTTTTCTTTGGTCCAACCATGTTTGTCTATACATGGCT
ACACCCCAATTCCCAGATGGACAGATTTCTTGCTCTCTCTGATGCAGTTCTCACTCCTTT
TTTAAATCCTGTTATCTACACATTCAGGAATAAAGTGATGAAGGCAGCAATGAAAAGAGC
TTTCAGACCATTAATGATTTTTAGAAAGATTTCA


Conceptual translation

MDGGNHSAVSEFVFLGLTHSWEIQLLLLVFSSVLYVASMTGNILIVFSVTIDPHLHSPMY
FLLASLSFTDLGACSATSPKMIYDLFRKHKVIPFGGCIAQIFFIHVIGGV/MVLLIAMA
FDRYVATCKPLHYLTIMSPQRCILFLAAAWALGVSHSLFQLAFVVNLPFCGPNVLDSFYC
DLPRLLRLACTDTYRLQFMVTVNSGFICVGSFFILLISYVFILFTVWKHSSGGSSKALST
LSAHITV/IFFFGPTMFVYTWLHPNSQMDRFLALSDAVLTPFLNPVIYTFRNKVMKAAM
KRAFRPLMIFRKIS