Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4F23P Olfactory Receptor

Gene Symbol OR4F23P
Organism Dog
Family 4
Subfamily F
Pseudo Yes
Location chr30:144941-145869 (+)

Sequence information


Nucleotide sequence

ATGGATGGAGCCAACGAATCTGTGGTATCTGAGTTTGTGTTCCTGGGACTCTCCAATTCA
TGGGAGATCCAGCTTCTTCTTTTCCTCATTTTCTCTGTGTTCTACATGGCAAGCCTAATG
GGAAACCTCCTTATCATGTTCTCTGTGAGAGTTGACCTTACATTGCACTCTCCTATGTAC
TTCCAGCTGGCAAACCTCTCCTTTCTTGATGTGGGGATTTGCTCTATTGCAGCCCCCAAA
ATGGTTTATGACCTTTTCAGAAAACACAAAACCATCTCTTTTGGAGGTTGTATACCTTCT
TTATTCATGCTATTGGGGGTACAGAAAAGGTGCTGCTCATTGCCATGGCCTTTGACAGAT
ATGTTGCCATATGTAAGCCTCTGCACTACCTGACCATCATGAGCCCATGAACGTGCATTT
TGATTTTGGTGGCAGCCTTGGTTCTCGGCCTCATTCACTCCGTGGCCCAACTGGCTTTTG
TTGTAGACTTGCCCTTCTGTGGTCCTAATGTATTGGACAGCTTTTATTGTGACCTTCCTC
AACTCATTAAACTTGCTTGCACGGAGACCAATAGATTGGAGTTCATGGTCACAGCCAACA
GTGGACTCATCTCTGTGGGTTCCTTCTTTATACTGATTATTTCTTACATCATCATTCTGA
CCATAGTATGGAAGCACTCTTCAGGTGGGTTATCCAAGCCCCTCTCCACTTTGTCAGCTC
ATGTCACTGTGGTGGTTTTATTCTTTGGGCCATTAATCTTCTTCTACACATGGCCCTTTC
TCTCATCACACTTGGACAAATTTCTTGCTATCTTTGATGCAGTTCTCACCTCTTTTCTGA
ATCCGGTCATCTACACATTCAGGAACAAAGAGATGAAGGTGGCAATGAAAAAACTCTGTC
ATCAGCTTGTGAATTACAGGAAGATACTC


Conceptual translation

MDGANESVVSEFVFLGLSNSWEIQLLLFLIFSVFYMASLMGNLLIMFSVRVDLTLHSPMY
FQLANLSFLDVGICSIAAPKMVYDLFRKHKTISFGGCIPSLFML/GGTEKVLLIAMAFD
RYVAICKPLHYLTIMSP*TCILILVAALVLGLIHSVAQLAFVVDLPFCGPNVLDSFYCDL
PQLIKLACTETNRLEFMVTANSGLISVGSFFILIISYIIILTIVWKHSSGGLSKPLSTLS
AHVTVVVLFFGPLIFFYTWPFLSSHLDKFLAIFDAVLTSFLNPVIYTFRNKEMKVAMKKL
CHQLVNYRKIL