Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4F33P Olfactory Receptor

Gene Symbol OR4F33P
Organism Dog
Family 4
Subfamily F
Pseudo Yes
Location chr10:16277974-16278813 (-)

Sequence information


Nucleotide sequence

ATGTATGAATCAAATTATTCTGATGTGTTTTGGTTTATATCCTTGGCACTTTCTACCTAT
AGACCAGCACTGAATTTTCTCCTTGCCTTTTCTCCAGTGTTTTATGTAACAGTTATCCTG
GGAAACCTCCTTGTTGTGTTTAGAGTGATGTTTACCCTTACTTACATTCCACTATGTACT
TCCTTTTAGCAAATCTCTCATTCATTGACTTGTGTCTTTCCACCTTAATGATTCCTAAGA
AGATTCATGACCTGCACTCAGGGCACAAAACCATATCCTTCCAGGGATGTGTCATCCATT
TATTTGTATTTCATGTCCTGGGTGGATCTGAGATGGTGCTGCTCATTGCCATGGTCTTGG
ATCGCCTATGTGGCCATATGTAAGCCTCTCCACTATCTGACTATCATGAGTCCGCAGATG
TGAATTTTGCTTCTGTCTGGTGCTTGGGCTGTTGGCCTCATTCATTCAGTGGCCCAGTTA
GCTTTCGTTGTCCACTTGACTTTTTGTGGTCCTAATGTGATAGACAGCTTTTGCTTTGAA
CTTCCTTGGTTCATCAAATGTGCCTGCGCAGACCCTTACAGGATGGAATTCATGGTGACT
GCCAACAGCAGGTTCATTTCCATGGGCGCCTTCTTCTCATTGCTTATCTCCTAAGTTTTC
ATCCTGGTCACTCTCTGGAAACGTTCCTCAGGTGGTTTGTCTAAGGCCTTTTCTACTCTG
TCAGCGCACATTAAAGAAGCTGTGATCTATGTATACAATGAAATATTACTCAGCCATCAG
AAATGGCGAATACCCACCATCTGTCTGGACGTAAATGGAACTGGAGGGTATTATGCTGAG


Conceptual translation

MYESNYSDVFWFISLALSTYRPALNFLLAFSPVFYVTVILGNLLVVFRVMF/PYLHSTM
YFLLANLSFIDLCLSTLMIPKKIHDLHSGHKTISFQGCVIHLFVFHVLGGSEMVLLIAMV
LDR\VAICKPLHYLTIMSPQM*ILLLSGAWAVGLIHSVAQLAFVVHLTFCGPNVIDSFC
FELPWFIKCACADPYRMEFMVTANSRFISMGAFFSLLIS*VFILVTLWKRSSGGLSKAFS
TLSAHIKEAVIYVYNEILLSHQKWRIPTICLDVNGTGGYYAE