Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4F34 Olfactory Receptor

Gene Symbol OR4F34
Organism Dog
Family 4
Subfamily F
Pseudo No
Location chr30:697463-698401 (-)
Aliases cOR4F34

Sequence information


Nucleotide sequence

ATGGGGGGAGGAAATAATTCGGTAGTGTCTGAGATTGTGTTGGTGGGACTCACCAGTTCT
TTGGAGATGCAGCTTGTCCTATTTCTAGTTTTCTCTGTGTTCTATGTAACAGGTATTTTA
GGAAACCTCCTCATTGTGCTCACAGTGATTTCTGACTCACATTTACATTCCCCCATGTAC
CTCCTGCTGGCCAACCTCTCCTTTATTGACATATGGGTTTCCTCCATTGCAGCTCCCAAG
ATGATCTCTGATTTTTTCAAGGAGAGAAAAGTAATCTCTTTCCAAGGCTGCATTGCTCAG
ATGTTCTTCATTCATGTTATTGGAGGAACTGAGATGGTTCTGCTCATTTTCATGGCCCTT
GACCGTTATGTTGCTATATGCAGGCCTCTCCACTATCTAGCCATCATGAACTTCAGAACT
TGCATTTCACTCCTGGTGGTGGCCTGGGCCATTGGGATCATCCACTCATTGATCCAACTG
GTGTTTGTTGTAAACCTGCCATTTTGTGGCCCCAATGAGGTGGACAGCTTTTACTGTGAT
CTTCCTCGATTTATTAGGCTTGCCTGCACAGACACCTACAGATTAGAGCTCATGGTCACT
GCCAATAGTGGCTTCATCTCTCTGGGAACTTTTTCCATTTTGGTTATTTCCTATATCTTC
ATCTTGGTCATCGTTTGGCAACGTTCCTCAGGTGGCTTGTCCAAGGCCCTCTCTACACTG
TCAGCTCACATAACAGTGGTGGTCTTATTTTTTGGTCCATGTATTTTTGTGTACTCATGG
CCATTTCCCACAGTGCCAGTGGATAAGTTCCTTGCCATTTTTGATGTAATTATTACTCCA
TTTCTGAACCCTGCCATCTACACTTTTAGGAATAAAGAGATGAAAGTGGCCATGAGGAGA
ATATTCAGTCAGGTGTTGAGCTTCCAGAAGCTGTTTAAG


Conceptual translation

MGGGNNSVVSEIVLVGLTSSLEMQLVLFLVFSVFYVTGILGNLLIVLTVISDSHLHSPMY
LLLANLSFIDIWVSSIAAPKMISDFFKERKVISFQGCIAQMFFIHVIGGTEMVLLIFMAL
DRYVAICRPLHYLAIMNFRTCISLLVVAWAIGIIHSLIQLVFVVNLPFCGPNEVDSFYCD
LPRFIRLACTDTYRLELMVTANSGFISLGTFSILVISYIFILVIVWQRSSGGLSKALSTL
SAHITVVVLFFGPCIFVYSWPFPTVPVDKFLAIFDVIITPFLNPAIYTFRNKEMKVAMRR
IFSQVLSFQKLFK