Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4G10 Olfactory Receptor

Gene Symbol OR4G10
Organism Dog
Family 4
Subfamily G
Pseudo No
Location chr30:537492-538427 (+)
Aliases cOR4G10

Sequence information


Nucleotide sequence

ATGTATGAAGCGAATTATTCTGAAGTGTCTCAGTTTGTATTCTTGGGACTTTCTACCTAT
AGACCAGTGCAGCATTTTCTCCTTGCCTTCTCTACAGTGTTTTATGTAACAATTGTTTTG
GGAAATCTCCTTGTAGTCTTTACAGTGACCTTTGATCCTTACTTACATTCCCCTATGTAC
TTCCTTTTAGCCAATCTTTCATTCGTTGACTTGTGTCTTTCCACCTTAACGGTTCCCAAG
ATGATATCTGACCTTCAATCAGGGCACAAAACTATATCCTTTCAAGGATGTGTCATCCAG
ATATTTGCCCTTCATGTCCTGGGTGGATCTGAGATGGTGCTGCTCATCTCCATGGCCTTG
GATCGATATGTGGCCATATGTAAGCCCCTCCACTACCTGACTATCATGAGCCCGCAGATG
TGCATTTTGCTTCTGTCTGGTGCTTGGGCTGTTGGCCTCATTCATTCAGTGGTCCAGTTA
GCTTTTGTTATCCATTTGCCTTTTTGTGGTCCTAATGAGATAGACAGCTTTTACTGTGAC
CTTCCTTGGTTCATCAAACTTGCCTGTGCAGACACTTACAGAATGGAATTCATGGTGACT
GCCAACAGTGGGTTCATTTCCATGGGCACCTTCTTCTCGTTGCTTATCTCCTATGTCTTC
ATTCTGGTCACTGTCTGGAAACGTTCCTCAGCTGGTTTGTCTAAGGCCTTTTCAACTCTG
TCAGCGCACATCACTGTGGTGGTTTTGTTCTTTGTACCGTGCATCTTTGTTTACGTGTGG
CCATTTCCCTCAGTGCCAGTGGATAAGTTTCTTGCCGTTTTGAACTTTGTGATTACACCC
ATTCTGAATCCTATTATCTACACATTGAGGAACAAAGACATGAAGATGGCACTGAAGAGA
CTGAGTAGTCAGCTCCTGAGTTTGAGAATGATCTCC


Conceptual translation

MYEANYSEVSQFVFLGLSTYRPVQHFLLAFSTVFYVTIVLGNLLVVFTVTFDPYLHSPMY
FLLANLSFVDLCLSTLTVPKMISDLQSGHKTISFQGCVIQIFALHVLGGSEMVLLISMAL
DRYVAICKPLHYLTIMSPQMCILLLSGAWAVGLIHSVVQLAFVIHLPFCGPNEIDSFYCD
LPWFIKLACADTYRMEFMVTANSGFISMGTFFSLLISYVFILVTVWKRSSAGLSKAFSTL
SAHITVVVLFFVPCIFVYVWPFPSVPVDKFLAVLNFVITPILNPIIYTLRNKDMKMALKR
LSSQLLSLRMIS