Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4K13CP Olfactory Receptor

Gene Symbol OR4K13CP
Organism Dog
Family 4
Subfamily K
Pseudo Yes
Location chr8:830731-831612 (+)

Sequence information


Nucleotide sequence

ATGGAAAGGGCAAACCATTCAGTGGTATCTGAGTTCATTTTGCTGGGACTTTCCAAATCT
CAGAATCTTCAGATTCTGTTCTTTGTAAGATTCTCTGTGGTCTATGCTGGGATTGTGTTA
GGAAACCTAATTTTGGTCACAGTGACCTTTGACTCATGCCTTCACACACAAATGTACTTT
CTGCTTATCAATATGTCCTGTATTGATATGATCCTAGCTTCTTTTGCTACCCCTAAGATT
ATTGTGGGTTTCCTCCAAAAACAGAAGACCATCTCTTGTTGGGGATGTTATTCTCAGATG
CTCTTCATGTACCTCCTAGGTGGGAATGAGATGATGTTGCTTGTAGCCATGGCAGTAGAC
AGGTATATTGCCATATGCAAACCCCTCCATTACATGACCATCATGAGCCCGCAAGTGCTT
GTTGGGCTGCTGTTATCTTCCTACGCAGTTGGCTTTGTGCACTGGTCTAGTCAAATGGCT
TTCATGTTGAATTTGCCCTTCTGTGTCCCAGTGTGGTGGACAGTTTTTTCTGTGACCTTC
CTCTTGTGATCAAACTTGCCTACCTTCTACAATTGCTGGCCATTGCTGACAGTGGCCTCC
TGTCCCTGATCTGCTTCCTCCTCTTGCTTGTCTCCTACACGATCATCATATACTCAGTCA
GGCACTATGCTGCCTGTGGTTCAGCCAAGGCCTTCTCCACTCTGTCAGCACACATCACAG
TTGTCACTGTCTTCTTTGCCCCATGTGTCTTTATCTATGTATGGCCCTTCAGCAGATATT
CTGTAGATAAAATTCTTTCCGTGTTTTATACAATTATCAATTATCACACCTCTCTTAAAT
CCTATTATTTATCCATTAAGGAATCAAGAAGTAAAAGAGCCA


Conceptual translation

MERANHSVVSEFILLGLSKSQNLQILFFVRFSVVYAGIVLGNLILVTVTFDSCLHTQMYF
LLINMSCIDMILASFATPKIIVGFLQKQKTISCWGCYSQMLFMYLLGGNEMMLLVAMAVD
RYIAICKPLHYMTIMSPQVLVGLLLSSYAVGFVHWSSQMAFMLNLPFC/PSVVDSFFCD
LPLVIKLAYLLQLLAIADSGLLSLICFLLLLVSYTIIIYSVRHYAACGSAKAFSTLSAHI
TVVTVFFAPCVFIYVWPFSRYSVDKILSVFYTIINY\PLLNPIIYPLRNQEVKEP