Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4P11 Olfactory Receptor

Gene Symbol OR4P11
Organism Dog
Family 4
Subfamily P
Pseudo No
Location chr18:40203220-40204158 (-)
Aliases cOR4P11, cOR4P11

Sequence information


Nucleotide sequence

ATGGAAAATATTAATAATGTCACTGAATTTGTTCTGTTGGGACTTTCCCAGAATAAGAAA
GTTAAAAACTTATGCTTTCTATTATTCTTATTTTGTTACATAGCTATTTGGATGGGAAAC
TTGCTCATAATGATTTCTATCACATGCAGTCAGCTAATTGACCAACCCATGTATTTCTTC
CTTAATAATCTTGCCCTCTCAGATCTGTGTTATACCTCAACAGTGACACCCAAGCTAGTC
ACTGACTTGCTGGTAGAAAGTAACATGATTTCTTATACTAACTGTATGGCACAGCTTTTT
GTCATGCATTTCTTTGGGGGGATTGAAGTCTTTATCCTCACGGGGATGGCCTATGACCGC
TACGTGGCCATCTGCAAGCCCTTGCACTACACCGTCATCATGAACAGAAAGAGATGTTAT
GGCATAGTCATTGCTAGCTGTACTGGGGCATTTCTGCATTCTTTTGTCCAATGTCTCCTT
ACCATCACTTTACCTTTCTGTGGCCCCAATGAGATAGATCACTACTTTTGTGATGTGTAT
CCTTTGCTGAAACTGGCCTGCACAGATACCTACAGAGTTGGGATCTTAGTGGTTGCCAAT
TCCGGCATGATGGGCTTGGTGACCTTTGTAGTCTTGGTTCTATCCTACTTATTGATATTA
TACACCATCAAGTCTTACCCTGCAGAGAGCCGCACCAAAGCTCTTTCCACCTGCAGCTCC
CATATCACAGTTGTGGTTCTGTTCTTTGTGCCTGTTCTCTTCATTTACATTCGCCCAGCC
ACAACTTTTCCAGAAGACAAAGTGTTTGCTCTTTTCTACACCATCATTGCTCCCATGTTC
AACCCTCTGATTTACACATTAAGAAACATGGAGATGAAAAATACCTTGAGGAAAGTGTGG
TGCCAGAAACCATGTTTGATTGGAAAGCAAATCATTATA


Conceptual translation

MENINNVTEFVLLGLSQNKKVKNLCFLLFLFCYIAIWMGNLLIMISITCSQLIDQPMYFF
LNNLALSDLCYTSTVTPKLVTDLLVESNMISYTNCMAQLFVMHFFGGIEVFILTGMAYDR
YVAICKPLHYTVIMNRKRCYGIVIASCTGAFLHSFVQCLLTITLPFCGPNEIDHYFCDVY
PLLKLACTDTYRVGILVVANSGMMGLVTFVVLVLSYLLILYTIKSYPAESRTKALSTCSS
HITVVVLFFVPVLFIYIRPATTFPEDKVFALFYTIIAPMFNPLIYTLRNMEMKNTLRKVW
CQKPCLIGKQIII