Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4P12P Olfactory Receptor

Gene Symbol OR4P12P
Organism Dog
Family 4
Subfamily P
Pseudo Yes
Location chr18:40695702-40696591 (-)

Sequence information


Nucleotide sequence

TTGGGACATGAAAATATCACAGAATTTAATCTCTTGGGACTTTTTAGTGATGAGGATGCA
AAGGCCGCCTGCTTTGTGCTGTTCGTACTTTGCTACATTGCAATTCTCTCAGGAAACTTG
CTCTATCTTCTCACAATCAGGGGCAGCCGTCTCCGTGAACAGCTCATGTACTTTTTCCTG
AGCTACCTATCTTTTATGGATGTCTGCTTCACTTCACAGACCTACTGGCCCAGCAGAAGA
CCATCTCCTACAATGGCTGCATGGCCCAGATGTTTTATGCCCATTTTTTTGGTGCCACTG
AGATCTTCATCTTGGTGGCCATGGCCTATGACCGATATGCAGCCATCTGCAGACCCCTTC
ACTATATGGTCATCATGAGCAGACAGGTGTGCTATGTCCTTGTAATGGCCTCAATTCTCG
GAGCATTTACCCATTCAATCATGCAAGTATTGATTATTATTGAACTTCCCTTCTGTGGCC
CCAATTAGATAGACCACTATTTCTGTGATGTTTTCCCCTTGCTGAAGCTGGCCTGCATGG
ATACTAGCTTGTTGGTTATTGTGATCATTACTACCACAGGAGTGCTGTCCATTTTGACCT
TTGTTGCCTTGGTAATTTCTTACATCATCATCCTGTCTACCCTGAGGACCTACTCATCCC
AGGGCTGCCGCAAAGCCCTCTCTACCTGTGGCTCACACATCACTGTTGTGTTCATGTTCT
TCTTGCCTCTCATCTTCACATATGTCCCCATGGCGGATTCCGTCAGTAATGACAAAGTGT
TTGCCCTATTTTATACCATGATTGCTCCCATGTTCAACCCTCTCATCTACACATTGAGAA
ACACAGACATGAAGAATGCCATGAGGAAAATGTGGTGCCGGGATGCACGG


Conceptual translation

LGHENITEFNLLGLFSDEDAKAACFVLFVLCYIAILSGNLLYLLTIRGSRLREQLMYFFL
SYLSFMDVCFTS/DLLAQQKTISYNGCMAQMFYAHFFGATEIFILVAMAYDRYAAICRP
LHYMVIMSRQVCYVLVMASILGAFTHSIMQVLIIIELPFCGPN*IDHYFCDVFPLLKLAC
MDTSLLVIVIITTTGVLSILTFVALVISYIIILSTLRTYSSQGCRKALSTCGSHITVVFM
FFLPLIFTYVPMADSVSNDKVFALFYTMIAPMFNPLIYTLRNTDMKNAMRKMWCRDAR