Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4P28P Olfactory Receptor

Gene Symbol OR4P28P
Organism Dog
Family 4
Subfamily P
Pseudo Yes
Location chr18:40428926-40429846 (-)

Sequence information


Nucleotide sequence

ATGACAAGCCAGAGAAACATCTCCGAATTCATACTTCTAGGACTTTCAAATGACCAGAGC
ATACAGATATTTTGTTTTGTCATTTTCTTACTCTGTTATGTTGCTCTGTTGGCAGGAAAT
CTTCTGATCCTTATCTCCATTCGATGCAGCCCTCTTTTTCACCAACCAATGTACTATTTC
CTTATACACTTATCCTTAATAGACATCTGCTACACCTCTACAGTTACACCCAAGTTAATT
GGTGACTTGCTAGTGGAAAGGAAAACCATCTCCTATGACAATTGCATGTTACAGGTCTTT
ACAATGCACTTCTTTGGAGGCATTGAGATCTTCATTCTCACCGCCATGGCCTTTGATCGC
TATGCTGCCATCTGCAAACCTCTCCACTACGTGATTATCATGAACAGGACAAGATGCAAT
CTCCTAGTCTTAGCTGCTTGGGCTGGTGGGGCCATTCATGCCTTTCCTTTACTTTCTACT
GCAATTGGTTTGCCCTTCTATGGTCCTAATGAAATTGATCACTACTTTTGTGATATTTTT
CCTTTGCTTAAAGTGGCCTGTACTGATACTTACATCACTAGTGTCCTTGTGATTGCCCTT
TCAGGAATGGTCACATTAGTTACCTTTATTGTCTTATCTGTTTCTTATGGTATTGTTCAC
TTTAAGAAATCTCTCAGCTGAAGGAAGACGCAAAGCCCTCTCTACCTGTTGGTCTCATAT
CACTGTGGTCATCTATATTTTGGGCCTGTAGTCTTTATGTACCTTAGGCCACTTATTACT
TTTCCTGAGGACAAAATATTTGCTATGTTTTACACCATCATTGCTCCTTTGTTCAATTCC
TTAATCTATTCTCTGAGAAATTCAGAGATGAAAAAAGCCATGAGGAAAGTTTGGTGTCCA
TCAGTATTTTCAAAGGAAGCA


Conceptual translation

MTSQRNISEFILLGLSNDQSIQIFCFVIFLLCYVALLAGNLLILISIRCSPLFHQPMYYF
LIHLSLIDICYTSTVTPKLIGDLLVERKTISYDNCMLQVFTMHFFGGIEIFILTAMAFDR
YAAICKPLHYVIIMNRTRCNLLVLAAWAGGAIHAFPLLSTAIGLPFYGPNEIDHYFCDIF
PLLKVACTDTYITSVLVIALSGMVTLVTFIVLSVSYGIV\LRNLSAEGRRKALSTCWSH
ITVV/LYFGPVVFMYLRPLITFPEDKIFAMFYTIIAPLFNSLIYSLRNSEMKKAMRKVW
CPSVFSKEA