Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4P30 Olfactory Receptor

Gene Symbol OR4P30
Organism Dog
Family 4
Subfamily P
Pseudo No
Location chr18:40292665-40293591 (-)
Aliases cOR4Y4, cOR4Y4

Sequence information


Nucleotide sequence

ATGACAAGCCAGAGAAACATCTCCGAATTCATACTTCTAGGACTTTCATATGACCAGAGC
ATACAAATATTTTGTTTTGTCATTTTCTTACTCTGTTATGTTGCTCTGTTGGCAGGAAAT
CTTCTGATCCTTATCTCCATTCGATGCAGCCCTCTTTTTCACCAACCAATGTACTACTTC
CTTATACACTTATCCTTAATAGACATCTGCTACACCTCTACAGTTACACCCAAGTTAATT
GGTGACTTGCTAGTGGAAAGGAAAACCATCTCCTATGACAATTGCATGTTACAGGTCTTT
ACAATGCACTTCTTTGGAGGCATCGAGATCTTCATTCTCACCGCCATGGCCTTTGATCGC
TATGCTGCCATCTGCAAACCTCTCCACTATGTGATTATCATGAACAGGACAAGATGCAAT
CTCCTAGTCTTAGCTGCTTGGGCTGGTGGGGCCATTCATGCCTTTCCTTTATTTTCTACT
GCAATTGGTTTGCCCTTCTGTGGTCCTAATGAAATTGATCACTATTTTTGTGATATTTTT
CCTTTGCTTAAAGTGGCCTGTACTGATACTTACATCACTGGTGTCCTTGTGATTGCCTTT
TCGGGTATGGTCGCATTAGTTACCTTTATTGTCTTATCTGTTTCTTATGGCATTATACTG
TTCACTTTAAGAAATCTCTCAGCTGAAGGAAGACGCAAAGCCCTCTCTACCTGTTGGTCT
CATATCACTGTGGTCATCTTATTTTTTGGGCCTGTAATCTTTATCTACCTTAGGCCACCT
ACTACTTTTCCTGAGGACAAAATATTTGCTCTGTTTTACACCATCATTGCTCCTATGTTC
AATCCCTTAATCTATACTCTGAGAAATTCAGAGATGAAAAAAGCCATGAGGAAAGTTTGG
TGTCCATCAGTATTTTCAAAGGAAGCA


Conceptual translation

MTSQRNISEFILLGLSYDQSIQIFCFVIFLLCYVALLAGNLLILISIRCSPLFHQPMYYF
LIHLSLIDICYTSTVTPKLIGDLLVERKTISYDNCMLQVFTMHFFGGIEIFILTAMAFDR
YAAICKPLHYVIIMNRTRCNLLVLAAWAGGAIHAFPLFSTAIGLPFCGPNEIDHYFCDIF
PLLKVACTDTYITGVLVIAFSGMVALVTFIVLSVSYGIILFTLRNLSAEGRRKALSTCWS
HITVVILFFGPVIFIYLRPPTTFPEDKIFALFYTIIAPMFNPLIYTLRNSEMKKAMRKVW
CPSVFSKEA