Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4P31 Olfactory Receptor

Gene Symbol OR4P31
Organism Dog
Family 4
Subfamily P
Pseudo No
Location chr18:40309146-40310054 (-)
Aliases cOR4Y2P, cOR4Y2P

Sequence information


Nucleotide sequence

ATGGAGAGCCAGAGGAATGTCTCAGAATTCATTCTTTTGGGACTTTCGCATGACCAGAAC
ATGCAAATATTTTGCTTTGTGCTCTTCTTATTCTGTTATGCTGCTCTCTTGGTAGGAAAC
CTTCTGATCCTTGTCTCTATTCGATGCAGCCCTCTTTTTCACCAACCAATGTACTACTTC
CTCAGCCACTTATCCACTCTGGACATCTGCTATACCTCTAGCGTTACACCCAAATTAATT
GCTGACCTGCTAGTGGAAAGAAAAGCCATCTCCTATGGTAATTGTATGTTACAGGTCTTT
GCCATGCACTTCTTTGGAATGATTGAAGTTCTAATCCTTACAGTCATGGCCTTTGATCGC
TATGCTGCCATCTGCAAACCTCTCCACTACCTGCTTATCATGAACAGGACAAGGTGCAAT
CTCCTAGTCTTAGCTGCTTGGGCTGGTGGGGCTGTCCACTCCTTTCCTCAATTTTGTATG
GTAATCAGGTTGCCCTTCTGTGGGCCTAATGAGATTGATCACTATTTCTGTGATATATTT
CCTTTGCTAAAGGTTGCCTGCACTGATACCTACATCACTGGTGTCCTTATGGTTGTCAAT
TCGGGAATGGTTACCTTAGTGACATTTGTGGTTTTATTTTTTTCTTATGTCATTATATTA
TTCACTTTAAGAAATCACTCAGCAGAAGGAAGACGCAAAGCCCTCTCTACTTGTGGATCT
CATATCACGGTTATAGTTTTATTTTTTGGGCCTTCCATCTTTGCCTACCTTAGACCTCCA
ACTAATTTCCCTGAGGATAAAGTATTTGCTCTGTTTTACACCATCATTGCTCCTATGTTC
AATCCCTTAATCTATACTCTGAGAAATTCAGAGATGAAAAATGCCATGAGAAAATTTTGG
TGTCAAACA


Conceptual translation

MESQRNVSEFILLGLSHDQNMQIFCFVLFLFCYAALLVGNLLILVSIRCSPLFHQPMYYF
LSHLSTLDICYTSSVTPKLIADLLVERKAISYGNCMLQVFAMHFFGMIEVLILTVMAFDR
YAAICKPLHYLLIMNRTRCNLLVLAAWAGGAVHSFPQFCMVIRLPFCGPNEIDHYFCDIF
PLLKVACTDTYITGVLMVVNSGMVTLVTFVVLFFSYVIILFTLRNHSAEGRRKALSTCGS
HITVIVLFFGPSIFAYLRPPTNFPEDKVFALFYTIIAPMFNPLIYTLRNSEMKNAMRKFW
CQT