Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4P32 Olfactory Receptor

Gene Symbol OR4P32
Organism Dog
Family 4
Subfamily P
Pseudo No
Location chr18:40257701-40258633 (-)
Aliases cOR4Y1, cOR4Y1

Sequence information


Nucleotide sequence

ATGGAGCGGCAGAGAAACATCTCAGAATTCATTCTTCTAGGACTTTCATATGACCAGAAC
ATGCAAATATTTTGCTTTGTACTCTTCTTATTCTGTTATATTGCCCTGTTGGTAGGAAAC
CTTCTAATCCTTGTCTCCATTCGATGCAGCCCTCTTTTTCACCAACCAATGTACTACTTC
CTCAGCCATTTATCCTCTATGGACATCTGCTATACCTCTAGCGTTACACCCAAATTAATT
GCTGACCTACTAGGGGGGACTAAAACCATCTCTTATGGTAATTGCATGTTACAAGTTTTT
GCCATGCACTTCTTTGGGAGTATTGAGGTCTTTGTCCTTACTGTCATGGCCTTTGATCGC
TATGTTGCTATTTGCAGGCCTCTCCACTACATGCTTATCATGAACAGGGCAAGGTGCCAT
CTCCTAGTCTTAGCTGCTTGGGCTGGTGGGGCTCTTCATTCTTTTCCTCAATTATCAATG
ACAATCCAATTGCCATTTTGTGGTCCTAATGAAATCGATCACTACTTTTGTGATATCTTC
CCTTTGCTGAAAGTTGCCTGCACTGATACTTACATCATTGGTGTCCTTGTGGTTGCCAAT
TCAGGTATGGTTGCCTTAGTTACCTTTGTTGTCTTATTTGTTTCTTATGTCATTATATTG
TTTAGTCTAAGACATCACTCAGCTGAGGGAAGACACAAAGCCCTTTCCACCTGTGGGTCT
CATATCACTGTTGTCATCTTATTCTTTGGGCCTTCAATCTTTGCCTACCTACGACCTCCA
ACTACTTTCCCTGAGGACAAAGTATTTGCTCTATTTTATACCATCATCGCTCCTATGTTC
AATCCCTTAATCTATACTCTGAGAAATGCAGAAATGAAAAATGCCATGACAAAAGTTTGG
TGTCAAACATTATTTTCAAGGAAAGCACACAAT


Conceptual translation

MERQRNISEFILLGLSYDQNMQIFCFVLFLFCYIALLVGNLLILVSIRCSPLFHQPMYYF
LSHLSSMDICYTSSVTPKLIADLLGGTKTISYGNCMLQVFAMHFFGSIEVFVLTVMAFDR
YVAICRPLHYMLIMNRARCHLLVLAAWAGGALHSFPQLSMTIQLPFCGPNEIDHYFCDIF
PLLKVACTDTYIIGVLVVANSGMVALVTFVVLFVSYVIILFSLRHHSAEGRHKALSTCGS
HITVVILFFGPSIFAYLRPPTTFPEDKVFALFYTIIAPMFNPLIYTLRNAEMKNAMTKVW
CQTLFSRKAHN