Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4P4 Olfactory Receptor

Gene Symbol OR4P4
Organism Dog
Family 4
Subfamily P
Pseudo No
Location chr18:40239348-40240322 (-)
Aliases cOR4P9, cOR4P9

Sequence information


Nucleotide sequence

ATGGATTCTGTATTTCAGGTGATTCATGTATTCTATCTATGCTGGACCATGGATCAAAGC
AATAACGTCACTGTATTCATTCTCTTGGGACTTTCCAAAAACAAGAACATTGAAATCCTT
TGTTTTGTATTATTTTTATTCTGCTACCTTGCTATTTGGATAGGAAACCTGCTTATAATG
ATTTCTATCATGTGCAGTCAGCTAATTGAGCAACCCATGTATTTCTTCCTTAATTACCTC
TCCGTCTCCGACCTTTGTTACACATCCACTGTGACACCCAAGCTAATGACTGACTTATTG
GCAGAAAGGAAGACCATTTCCTACAGTAACTGCATGACACAACTCTTTACCACACATTTA
TTTGGAGGCATCGAGATCTTCATTCTCACAGGGATGGCCTATGACCGCTACGTGGCCATC
TGCAAACCCCTGCACTACACCATCATCATGAGCAGACAGAGATGTAATGCAATCATCGCA
GCCTGCTGTACGGGGGCGTTTATACATTCCACCAGTCAGTTCCTTCTCACCATCTTCCTG
CCGTTCTGTGGCCCCAATGAGATAGATCACTACTTCTGTGATGTGTATCCTTTACTGAAG
CTGGCCTGTTCTAATACACACGCCATAGGTCTCTTAGTCATTGCTAATTCAGGCCTAATT
GCTTTGGTGACCTTTGCTGTGCTGACGCTGTCTTATTGTTTTATACTGTGCAGCATCAGG
GCATATTCTGCACAGAGTCGCAGCAAAGCTCTTGCCACCTGCACTTCTCACCTCACAGTC
GTGGTTCTATTTTTTGCACCTGCACTGTTCATTTACCTTCGCCCAGCCACAACTTTCCCA
GAAGACAAAGTGTTGGCTCTTTTCTACACCATCATTGCCCCCATGTTCAATCCTCTGATC
TACACGCTGAGAAACACGGAGATGAAGAATGCCTTGAGGAAAGTGTGGTGTCATCATGCA
CTCCTAGAAGGAAAG


Conceptual translation

MDSVFQVIHVFYLCWTMDQSNNVTVFILLGLSKNKNIEILCFVLFLFCYLAIWIGNLLIM
ISIMCSQLIEQPMYFFLNYLSVSDLCYTSTVTPKLMTDLLAERKTISYSNCMTQLFTTHL
FGGIEIFILTGMAYDRYVAICKPLHYTIIMSRQRCNAIIAACCTGAFIHSTSQFLLTIFL
PFCGPNEIDHYFCDVYPLLKLACSNTHAIGLLVIANSGLIALVTFAVLTLSYCFILCSIR
AYSAQSRSKALATCTSHLTVVVLFFAPALFIYLRPATTFPEDKVLALFYTIIAPMFNPLI
YTLRNTEMKNALRKVWCHHALLEGK