Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4P4C Olfactory Receptor

Gene Symbol OR4P4C
Organism Dog
Family 4
Subfamily P
Pseudo No
Location chr18:40216241-40217221 (-)
Aliases cOR4P5, cOR4P5

Sequence information


Nucleotide sequence

ATGGAAAATAGGAACAACATCACTATGTTTATTCTCTTGGGACTGTCTCAAAACAAGAAC
ATTGAAATCCTCTGCTTTGTATTAGTTTTATTTTGCTACCTTGCTATTTGGGTGGGAAAT
TTGCTCATAATGATTTCTATCACGTGCAGTCAGCTAATTGAGCAACCCATGTATTTCTTC
CTTAATTATCTCTCACTCTCTGACCTTTGCTACACGTCAACAGTGACACCTAAACTAATG
ACTGATTTACTGTCAGAAAGGAAGACCATTTCCTACAGTAACTGCATGACACAGCTTTTT
ATCCTGCACTTTCTCGGAGGTGTTGAGATCTTTATCCTCACAGGGATGGCCTATGACCGC
TACGTGGCCATTTGCAAGCCCTTGCACTACACCATCATCATGAGCAGACAGAGATGCAAT
GCAATCATCACAGCCTGTTGTACGGGGGCGTTTATACACTCCGCCAGTCAGTTCCTTCTC
ACCATCTTCCTGCCGTTCTGTGGCCCCAATGAGATAGATCACTACTTCTGTGATGTGTAT
CCTTTACTGAAGCTGGCCTGCACTGACACACGTAGAATTGGTCTCTTGGTAATTGTTAAT
TCAGGTCTGATCGCTCTGCTGACTTTTGTGATTTTGATGGTGTCCTATTTTCTGATATTA
TACACCATCATGACCTACCCTGCAGAGAGCCGCACCAAAGCTCTTTCCACTTGCAGTTCC
CATATCACAGTTGTGGTTCTGTTCTTTGTGCCAGTTCTCTTCATTTACATTCGCCCAGCC
ACAACTTTTCCAGAAGACAAAGTGTTTGCTCTTTTCTACACCATCATTGCTCCTATGTTC
AATCCTCTAATCTACACCCTGAGAAACATGGAGATGAAGAATGCCTTGAGGAAAGTGTGG
TGTCATCGTTTATTTTTGGAAGGGAGGGAACTCATATTAAAAGCATTCCAGAATTTCACT
TTAGGATTCTACCCTGAGCCC


Conceptual translation

MENRNNITMFILLGLSQNKNIEILCFVLVLFCYLAIWVGNLLIMISITCSQLIEQPMYFF
LNYLSLSDLCYTSTVTPKLMTDLLSERKTISYSNCMTQLFILHFLGGVEIFILTGMAYDR
YVAICKPLHYTIIMSRQRCNAIITACCTGAFIHSASQFLLTIFLPFCGPNEIDHYFCDVY
PLLKLACTDTRRIGLLVIVNSGLIALLTFVILMVSYFLILYTIMTYPAESRTKALSTCSS
HITVVVLFFVPVLFIYIRPATTFPEDKVFALFYTIIAPMFNPLIYTLRNMEMKNALRKVW
CHRLFLEGRELILKAFQNFTLGFYPEP