Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4P6 Olfactory Receptor

Gene Symbol OR4P6
Organism Dog
Family 4
Subfamily P
Pseudo No
Location chr18:40198720-40199709 (+)
Aliases cOR4P6, cOR4P6

Sequence information


Nucleotide sequence

ATGATTTGCTTCATTGTTTTTGTCATTTCAGATACCTTTCTGGAGCATCAGATCATGGAA
AATAGGAACAATGTTACTGAATTTATTCTCTTGGGACTTTCTAAGAATAAGAAAGTCCAA
ATCCTCTGCTTTTTATTTTTCTTACTCTGTTATCTAGCTATCTGGTTGGGGAATTTGATT
ATTATGGCTTCCATCACATGCAGTCAGCTAATTAATCAGCCCATGTATTTCTTCCTTAAT
TACCTTGCCCTCTCAGACCTCCTCTATACCTCCACTGTGACACCCAAACTAATGACAGAC
TTACTGACAGAGAATAAGGTCATTTCCTATAAAAACTGCATGACACAGCTATTTACTACA
CATTTCTTTGGAGGGGTTGAGGTCTTCATCATCACAGGAATGGCCTATGATCGCTATGTG
GCCATCTGCAAACCACTCCACTATGCCATCCTCATGAATAGGCAAAGATGTAACTCAATT
CTCAGAGCATCATGTGCAGGGGGGTTTCTGCATTCCCTTGGCCTGTTTCTTCTTACAATT
TTTTTACCTTTTTGTGGACCCAATGAAATAGATCACTATTTCTGTGATGTGTATCCTTTG
TTGAAACTGGCATGCATTGATACACACAAAATTGGTTTCTTAGTCATTGCCAATTCTGGC
CTGATGGGACTGGTGATCTTTGTGGTTTTGATGGCCTCCTACTTTATGATATTATATAAT
GTGAGAGCATATTCTGCAGAGAACCGCCACAAGGCGCTTTCCACTTGCAGCTCCCACATC
ACAGTTGTGATCCTGTTTTTTGCACCTGTCATCTTTGTTTACATTAGGCCTGCCACAACT
TTACCAGAGGATAAAGTATTTACACTCTTCTACACAATTATCGTCCCCATGCTCAATCCT
CTTATCTATACACTTAGAAACACAGAGATGAAAAATGCCATAAGGAAAGTTTGGTGCACT
GAAAGGTTTTGGAAAGGGAAACCAATGATT


Conceptual translation

MICFIVFVISDTFLEHQIMENRNNVTEFILLGLSKNKKVQILCFLFFLLCYLAIWLGNLI
IMASITCSQLINQPMYFFLNYLALSDLLYTSTVTPKLMTDLLTENKVISYKNCMTQLFTT
HFFGGVEVFIITGMAYDRYVAICKPLHYAILMNRQRCNSILRASCAGGFLHSLGLFLLTI
FLPFCGPNEIDHYFCDVYPLLKLACIDTHKIGFLVIANSGLMGLVIFVVLMASYFMILYN
VRAYSAENRHKALSTCSSHITVVILFFAPVIFVYIRPATTLPEDKVFTLFYTIIVPMLNP
LIYTLRNTEMKNAIRKVWCTERFWKGKPMI