Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4P7 Olfactory Receptor

Gene Symbol OR4P7
Organism Dog
Family 4
Subfamily P
Pseudo No
Location chr18:40176964-40177893 (+)
Aliases cOR4P7, cOR4P7

Sequence information


Nucleotide sequence

ATGGAAAATAGGAATAACATCACAGAATTTATTCTTTTAGGACTTTCTCAGAAAAAGGAA
ATAGAAGTCCTCTGCTTTTTACTGTTCTTACTCTGTTACATTGCAATTTTGATTGGAAAC
CTACTTGTCATGATTTCTATCATCTGCAGTCAACTTATTAACCACCCAATGTATTTCTTC
TTGAGTTTCCTATCCCTGGCAGACCTTTGTTACACCTCCACTGTGACCCCCAAGTTAATC
ATTGACTTGCTGTCTGAAAAGAAGGTCATTTCCTACAATGGCTGCATGACACAGCTCTTT
ACCATGCACTTCTTTGGAGGAATTGAGGTCTTCATCCTCACCGGGATGGCCTATGACCGT
TATGTGGCCATCTGCAAACCCCTGCACTACACCCTCCTCATGAGCCGGTGGAAATGTGAT
GCCATTCTTGCAGCTTCCTGTATTGGTGGATTCCTTCATTCCTTCGGTCAGTTTCTCCTT
GCCATCGTTTTACCCTACTGTGGCCCCAATGAAATAGATCACTTCTTCTGCGATGTGTAC
CCTTTGCTGAAGCTGGCTTGCAAGGATACAAGCAGAATCGGTCTTCTGGTCGTTGCCAAT
TCGGGACTGATGGGTCTGGTGACTTTTGTCGTCTTGCTGGTATCTTATGCTGTGATCCTA
TATACTATCAGGTCCTACTCTGCAGAGAATCGTCACAAAGCTCTTTCCACATGCAGTTCC
CACATCACTGTGGTGGTTCTCTTTTTTGCTCCTTTACTCTTTATTTATATTCGACCAGCA
ACTACATTACCAGAAGACAAAGTGTTTGCTCTTTTTTACACTGTCTTTGCCCCTATGCTC
AACCCTCTCATATACACACTAAGAAACATGGAGATGAAGAATGCCATAAGGAAATTTTGG
TGCCACGTCATGGGAAGTAAGGACATAAAC


Conceptual translation

MENRNNITEFILLGLSQKKEIEVLCFLLFLLCYIAILIGNLLVMISIICSQLINHPMYFF
LSFLSLADLCYTSTVTPKLIIDLLSEKKVISYNGCMTQLFTMHFFGGIEVFILTGMAYDR
YVAICKPLHYTLLMSRWKCDAILAASCIGGFLHSFGQFLLAIVLPYCGPNEIDHFFCDVY
PLLKLACKDTSRIGLLVVANSGLMGLVTFVVLLVSYAVILYTIRSYSAENRHKALSTCSS
HITVVVLFFAPLLFIYIRPATTLPEDKVFALFYTVFAPMLNPLIYTLRNMEMKNAIRKFW
CHVMGSKDIN