Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4Q8P Olfactory Receptor

Gene Symbol OR4Q8P
Organism Dog
Family 4
Subfamily Q
Pseudo Yes
Location chr10:16269862-16270567 (+)

Sequence information


Nucleotide sequence

ATGGATGAAAACCAAAGAGAGATGGTGAGAATCTTTGTCCTGGAAGGTTCTCACAGACAC
CACCTATCGAGGCAGGGGTATTTGTACTATTTATTTTCTTCTATGTGCCCACTTGGGTAG
GCAATGTCCTCATCTTGGTCACAGTAGCCTCTGATAACTATCTGAATTCATCACCCATGT
ATTTCCTTCTTGGCAACCCCTCTTTCCTGGACTTACGTTATTCAACTATCCCTAAGCTTC
TGGCTGACTTTCTTGATAATGAGAAGCTCATTCGCTATGGCCAATGCATTGTGCAGCTCT
TCTTTCTGCATTTTGTAGGAGCAGTTGAGATGTTCCTGCTTACAGTGATGGCCTATGATC
TTTATGTTGCAATTTGTTGCCCTCTGCACTATACCACTATTATGAGTCAAGGATTACGCT
GTATGTTGGTAGCTGCTTCCTGGATGGGAGTGTTTGTGTAATCTACTGTCCAGAGGATCC
TTGCTATACGTTTGCCTTTTTTGTGGACCAAACCAGGTGGACAACTTCTTTTGTGATGTT
CCCCCATCATCAAACTTGCCTGTGTGGACACATTATTATTGAATTACTAATGGCATCTAA
CAGTGGGTTAATCTCTACCAGTTCCTTTATTATACTGTTTTCTTCCTATTCCACTATCCT
GGTCAAGATTCGCTCCAAGGAGGGAAGGCGAAAGGCACTCGCCACC


Conceptual translation

MDENQREMVRIFVLEG/SQTPPIEAGVFVLFIFFYVPTWVGNVLILVTVASDNYLNSSP
MYFLLGNPSFLDLRYSTIPKLLADFLDNEKLIRYGQCIVQLFFLHFVGAVEMFLLTVMAY
DLYVAICCPLHYTTIMSQGLRCMLVAASWMGVFV*STVQRILAIRLPF\GPNQVDNFFC
DVP/IIKLACVDT/IIELLMASNSGLISTSSFIILFSSYSTILVKIRSKEGRRKALAT