Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4S1B Olfactory Receptor

Gene Symbol OR4S1B
Organism Dog
Family 4
Subfamily S
Pseudo No
Location chr18:41493200-41494126 (-)
Aliases cOR4S4, cOR4S4

Sequence information


Nucleotide sequence

ATGGGAACCAAGAACAACGTGACTGAATTTGTGTTGTTCGGCCTTTTCCAGAGCAGGGAG
ATGCAGCTTGTGTGCTTTGTGGTCTTCTCCCTCTTCCACGTGCTCACTGTCCTGGGGAAC
CTTCTGGTCATCATCATCATCAATGCCAGCAAGACCCTGAATTCTCCCATGTATTTCTTC
CTCAGCCACCTGTCTTTTGCGGACATGTGCTATCCATCTGCTACCACACCCAAGATGATT
GCTAACAGTTTCATGGAGCGAAAGACCATCTCCTTCAATGGCTGCATGACCCAGCTCTTT
TCTGCCCACTTCTTTGGTTGCACTGAGATCTTTCTCCTCACAGCTATGGCCTATGACCGC
TATGTGGCCATCTGTAGGCCCCTGCACTACACGGCTATCATGGATCGGTGGAAGTGTGGT
CTGCTGGCAGGGGCCTCCTGGGTGGGTGGCTTTCTGCATTCCATCCTACAGACCCTCCTC
ACAGTCCAGCTGCCCTTTTGTGGGCCTAATGAGATTGACAACTTCTTCTGTGATGTTCAT
CCCTTGCTGAAGCTGGCCTGTGCTGACACTTATTTGGTGGGGCTCATTGTGATGGTCAAC
AGTAGTATGATCACTTTGGGGTCCTTTATCATCCTTATCATCTCCTACATGGTCATCTTA
CTGAACCTGAGAAACCAGTCATCTGAGGGCTGGCGTAAGGCTCTCTCTACATGTGGCTCA
CACATCATCACTGTTCTTTTGGTCCTTCTGCCCCCCATGTTCATGTATACTCGTCCCTCC
ACCACCCTGGCTGCTGACAAACTTGTCATCCTCTTTAACATTGTCATGCCACCTTTGCTG
AACCCTCTGATCTACACTTTGAGGAACAATGAGGTGAAAAATGCAATGAGGAAACTGTTT
AGAGTAGAGGGGAGCATGGGGGAGAAG


Conceptual translation

MGTKNNVTEFVLFGLFQSREMQLVCFVVFSLFHVLTVLGNLLVIIIINASKTLNSPMYFF
LSHLSFADMCYPSATTPKMIANSFMERKTISFNGCMTQLFSAHFFGCTEIFLLTAMAYDR
YVAICRPLHYTAIMDRWKCGLLAGASWVGGFLHSILQTLLTVQLPFCGPNEIDNFFCDVH
PLLKLACADTYLVGLIVMVNSSMITLGSFIILIISYMVILLNLRNQSSEGWRKALSTCGS
HIITVLLVLLPPMFMYTRPSTTLAADKLVILFNIVMPPLLNPLIYTLRNNEVKNAMRKLF
RVEGSMGEK