Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4S7 Olfactory Receptor

Gene Symbol OR4S7
Organism Dog
Family 4
Subfamily S
Pseudo No
Location chr18:41,570,700-41,571,800 (+)
Aliases cOR4S7

Sequence information


Nucleotide sequence

ATGGTACCATGTTCCCAAATCCAATTTTCCTTCAATTTTCTTCATATAGATAATGCTACA
CTGTATTTCTCTCTTGTGAACTTCCCAGGTTCCATGGAAAATAATGTTACTGAGTTTATC
TTCATGGGTCTTTCCCAAAATGAGAAAGTGCAACAACTATGCTTCTTTTTGTTCTTATTC
TTTTATATGATACTCATGACTGGAAATTTTCTCATTATAATGACTATTCAAAGGAGTTCA
AATCTCAACTCTCCCATGTACTTTTTCCTTAGCTTCCTATCATTTGTGGACATCTGCTAT
TCCTCTGTTACAGCTCCCAAGCTGATTATTGATTCCTACGCCAAAGTCAAGAGCATCTCC
TTTGTTGGTTGTATGGCCCAGCTCTTTTTCTGCCATCTATTTGGCTGCACAGAGATCTTC
ATTCTCACAGTGATGGCCTATGACAGGTATGTGGCTATCTGTAAGCCTCTACGCTATATG
ACCATCATGGACCGGAAGGTCTGCTCCATACTGGTGGCAACCTGTTGGTTAGGAGGGTTT
GTGCATTCCTTTATCCAGACCATCCTCACTGTACAACTGCCTTTCTGTGGCCCTAACCTA
ATTGACCACTACTTCTGTGATGTCCACCCTTTACTGAAGCTGGCTTGCATAGACACAAAA
GTTGTGGGACTCATTGTGATAGCAAACAGTGGTATGATTTCACTGAGCTGTTTTGTCATT
CTTGTTGGCTCTTACATTGTCATCTTGCTTTCCTTTAAGACCCGTTCATCAGAAGGGAGG
CGTAAGGCCCTGTCCACATGTGCTTCTCACATCATAGTGGTGATCTTGTTTTTTGTCCCC
TGCCTCTTCATCTACCTAAGGCCTTCCACCACTTTTACTGAAGACAAGATGGTGGCTGTG
TTTTATACCATCATCACACCCATGTTAAACCCTCTGATCTATACCCTGAGAAACATGGAA
GTGAAAAATGCCATGAAGAGACTGTGGATGGAGAAGTTGGTGGTCAGAAATAAGAGAGGC
TCTGGTGTAAACCTCAATGGGATTGATAGAGCTTCAGTTGTACCAGTTTCCAAAAGGATT
GCTGGGAACAAGTCAGTAATCATCCCT


Conceptual translation

MVPCSQIQFSFNFLHIDNATLYFSLVNFPGSMENNVTEFIFMGLSQNEKVQQLCFFLFLF
FYMILMTGNFLIIMTIQRSSNLNSPMYFFLSFLSFVDICYSSVTAPKLIIDSYAKVKSIS
FVGCMAQLFFCHLFGCTEIFILTVMAYDRYVAICKPLRYMTIMDRKVCSILVATCWLGGF
VHSFIQTILTVQLPFCGPNLIDHYFCDVHPLLKLACIDTKVVGLIVIANSGMISLSCFVI
LVGSYIVILLSFKTRSSEGRRKALSTCASHIIVVILFFVPCLFIYLRPSTTFTEDKMVAV
FYTIITPMLNPLIYTLRNMEVKNAMKRLWMEKLVVRNKRGSGVNLNGIDRASVVPVSKRI
AGNKSVIIP