Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4X2 Olfactory Receptor

Gene Symbol OR4X2
Organism Dog
Family 4
Subfamily X
Pseudo No
Location chr18:41526401-41527327 (-)
Aliases cOR4X6, cOR4X6

Sequence information


Nucleotide sequence

ATGGGTAACACACACAATGTGACCGAATTCGTTTTTCTGGGACTTTCTTCCAATCAGGAT
GTACAGAAAGTTTTCTTTGTGCTGTTTCTGTTTTTGTACACAGCAGTTGTGCTGGGGAAT
CTCCTCATTGTGCTCATTGTCATGACCAGCAGAAGGCTTGGTTCCCCCATGTACTTCTTC
CTCAGCTATCTATCCTTTGTGGAGATCTGCTACTCCTCTACAACAGCACCCAAACTCATC
TCGGATTTGCTGGCTGAAAGGAAAGCAATTTCTTTGTGGGGCTGCATGACACAGCTTTTT
TTCATGCACTTCTTCGGTGGCACTGAGATCCTCCTGCTCACTGTGATGGCCTATGACCGC
TATGTGGCCATCTGTAGGCCCCTCAACTATACCGTTATGATGAACCGGCAGGTATGCGCT
GTCCTGGTGGGAATGGCATGGGTGGGAGGCTTTGTACATTCCTTTGCCCAAATCCTTTTG
ATCTTCCGCTTGCCCTTCTGCGGTCCCAATGTGATTGACCACTATTTCTGTGACCTGCTT
CCTGTGCTCAAACTTGCCTGCTCTGACACCTTCCTCATTGGTGTGCTGATTGTTGCCAAT
GGGGGGACCTTGTCTGTGATCAGCTTTGGGATCATCTTAGCCTCCTACGTGGTCATTTTG
CTCCATTTGAGGACTCGAAGCTCTGAGGGGCGGAGCAAGGCCCTCTCCACCTGTGGGTCC
CATATCACTGTGGTTACCTTATTCTTTGGGCCATGTATCTTCATCTATCTGAGGCCTTCT
ACCACCTTGTCTGCAGACAAGACAGTGGCTGTGTTCTACACAGTGATCACCCCACTCCTC
AACCCTGTCATTTACTCCCTAAGAAATGCTGAAGTGAAGAAGGCCATGAAGAAGCTGTGG
ATCAGGACGATGAAGCTAGAAGAGAAA


Conceptual translation

MGNTHNVTEFVFLGLSSNQDVQKVFFVLFLFLYTAVVLGNLLIVLIVMTSRRLGSPMYFF
LSYLSFVEICYSSTTAPKLISDLLAERKAISLWGCMTQLFFMHFFGGTEILLLTVMAYDR
YVAICRPLNYTVMMNRQVCAVLVGMAWVGGFVHSFAQILLIFRLPFCGPNVIDHYFCDLL
PVLKLACSDTFLIGVLIVANGGTLSVISFGIILASYVVILLHLRTRSSEGRSKALSTCGS
HITVVTLFFGPCIFIYLRPSTTLSADKTVAVFYTVITPLLNPVIYSLRNAEVKKAMKKLW
IRTMKLEEK