Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR4X5 Olfactory Receptor

Gene Symbol OR4X5
Organism Dog
Family 4
Subfamily X
Pseudo No
Location chr18:41513021-41513947 (-)
Aliases cOR4X5P, cOR4X5P

Sequence information


Nucleotide sequence

ATGGCGACTCCAAGCAATGTGACTGAAATCATTCTCTTGGGATTTTCCCCCAACAGGGAG
GTGCAGAAGACTGTTTCTGTGCTGTTTCTCCTCATGTACATGGCCATTGTGCTGGGTAAC
GGCCTTATTGTGGTGATGGTGATGGCCAGCAAAGGGCTCACCTCCCCCATGTATTTCTTC
CTCAGCTTCCTGTCCTTTGTGGAGATCTGTTACTGCTCTGTCACAGCCCCCAAGCTCATC
CTTGACTCTTTTATTGAAAGGCAAACCATTTCCCTCAAGGGCTGCATCACACAGATATTT
TTCCTCCATTTCTTTGGTGGTACTGAGATCTTTCTCCTGACAGTGATGGCCTATGACCGC
TATGTGGCCATCTGCAAGCCCCTGCACTATACCGTCATCATGAACCGGCGTGTGTGTGGC
CTCCTGGTGGGTGCAGCATGGAGTGGGGGCTTGCTGCATTCTGTTGGGCAGACATTCCTC
ATTTTCCAGCTGCCCTTCTGTGGCCTCAAGGTCCTTGACCACTACTTCTGTGATGTCCAT
CCTGTATTGAAGCTGGTCTGCTCAGACACCTTCCTCATTGGTGTGCTGATCATCGCCAAT
GGTGGCTCCATTTCAGTGGTCAGCTTCATGGGGCTGCTTGCTTCCTACGTGGTCATCCTG
TACTCCCTGAGGACACAGACCTCAGAAGGTCGGCGCAAGGCTCTGTCCACCTGTGCCTCT
CACATTGCAGTTGTGAGTCTGTTCTTCATACCCTGTTCCTTTGTCTACATGAGGCCCTGT
GTCACCCTCCCTGCAGACAAGATAGTTGCTGTGTTTTACACAGTGGTCACACCTCTCTTA
AACCCCATCATTTACTCCTTCAGGAATGCTGACATGAAAAATGCCATGAGAAGACTGATG
GGGAGGACAGTGATCTGGGGAAATAGA


Conceptual translation

MATPSNVTEIILLGFSPNREVQKTVSVLFLLMYMAIVLGNGLIVVMVMASKGLTSPMYFF
LSFLSFVEICYCSVTAPKLILDSFIERQTISLKGCITQIFFLHFFGGTEIFLLTVMAYDR
YVAICKPLHYTVIMNRRVCGLLVGAAWSGGLLHSVGQTFLIFQLPFCGLKVLDHYFCDVH
PVLKLVCSDTFLIGVLIIANGGSISVVSFMGLLASYVVILYSLRTQTSEGRRKALSTCAS
HIAVVSLFFIPCSFVYMRPCVTLPADKIVAVFYTVVTPLLNPIIYSFRNADMKNAMRRLM
GRTVIWGNR