Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR51A47P Olfactory Receptor

Gene Symbol OR51A47P
Organism Dog
Family 51
Subfamily A
Pseudo Yes
Location chr21:28,496,100-28,497,000 (+)
Aliases cOR51I3P

Sequence information


Nucleotide sequence

ATGGGAGGTAAGCCCCACAACAGCTCAGACTTGCCTCCTTTCACCCTGTCAGGGTTCCCA
GGGCTGGAGACTTCCCAACATTGGATGTTTCTGCTCTTTGGTATCCTCTACATTGTCTCC
ATTGTGGGCAATGCCCTTATCCTTTTCATCATCAAGGAGGTACAGAGTTTGCATAAGCCT
ATGTACTACTTCCTATCCCTGCTGTCAGTTAATGACCTAGGTGTGTCCTTTTCCACACTG
CCCACCGTGTTGGCCACATTTTGCTTAAGAGAGATCGGCTTTGATTCTTACATGGCTCAA
ATGTTTTTTATCCACCTCTTCTCCTTTATGGAGTCTGGAGTTCTCCTGGTTATGAGTTTT
GACCGCTATGTGGCCATCTGTAACCCCTTGCGCTATGCCACAGTGCTCACTGATGCACCT
GTGTGGTGCGCCTGGGCATAGCTGTTGTCATCCGTGGTTTCTGTATGGTTTTCCCACTGC
CCTTCCTTCTGAAGAGGTTGTCCTTCTGCAAGGCCAATGTACTCTCTCATCCTTACTGCC
TGCATCCAGATCTGATCCGCTTGCCCTGTGGTGACATTACCATCAATAATATTTTTGGTC
AATTCATTGTCATCTCTAACTTTGGTCTGGATTCTGCTCTCATTCTCCTCTCCTACATGC
TCATCCTGCGCTCTGTACTTGCTATTGCCTCCCGGGAGGAAAGACTTAAGACCCTCAATA
CGTGTGTGTCACACATGTGTGCTGTGCTTATGTTCTTTGTGCCTATGGTCGGTGTGTCCA
TGGCCGCTCGCTATGGGAGGCATGCCCCACAGTATGTACATACACTCATGTCCCTCATCT
ACCTTTTTGTACCTCCTATGCTCAACCCAGTCATCTATTCCATCAAAACCAAAGAGATCC
GTCAAAGGCTTTGCAAAATACTACTGGGAACAAGGTTT


Conceptual translation

MGGKPHNSSDLPPFTLSGFPGLETSQHWMFLLFGILYIVSIVGNALILFIIKEVQSLHKP
MYYFLSLLSVNDLGVSFSTLPTVLATFCLREIGFDSYMAQMFFIHLFSFMESGVLLVMSF
DRYVAICNPLRYATVLTDAPVWCAWA*LLSSVVSVWFS/LPFLLKRLSFCKANVLSHPY
CLHPDLIRLPCGDITINNIFGQFIVISNFGLDSALILLSYMLILRSVLAIASREERLKTL
NTCVSHMCAVLMFFVPMVGVSMAARYGRHAPQYVHTLMSLIYLFVPPMLNPVIYSIKTKE
IRQRLCKILLGTRF