Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR51AB4 Olfactory Receptor

Gene Symbol OR51AB4
Organism Dog
Family 51
Subfamily AB
Pseudo No
Location chr21:27891543-27892496 (+)

Sequence information


Nucleotide sequence

ATGTTGGCTTTTAATAGCACTGCCTCTAATTGGCCCACTTTCTCCTTCATTGGTATTCCT
GGTCTGGAGGCTGCACATATATGGATCTCCATCCCCTTCTGTGTCCTGTACATCATGGCC
CTTGGGGGCAATGCTCTTCTGCTTATCCTAGTTACAGCAGAGCAGAATCTTCATGAACCT
CAGTTCTATTTTTTGGCTGTGCTTGCTCTTACTGACCTAGGTCTTTCATTGTCTACAATG
CCTAGTGTCTTGGCTGTCTTCTGGTTTGATGCCCGACACATTGGCCTGGATGCCTGCTTA
ACCCAAATGTTCTTCATTCACACCCTCTCCTCAGTAGAATCAGGTATTCTTGTGGCCATG
GCTTTTGACCGTTTGGTAGCTATCTGCGCTCCATTAAACTACACCAGGATCCTTACCCAC
TATACTGTTGCCTGCCTTAGTGGAGCTGCTGTCTTACGAGGCACCACTCTGCTGGCTCCT
CTGCCTTTTTTCCTTAAGACTTTTCCTTTCTGTGGGACCAATATCCTCTCACATTCTTAT
TGCTACTACCCAGATATGCTCAACCTGGCCTGTGGGGATGTCTCTTTCAGCAGTGCCTAT
GGGTTGGTTTTTGTCCTTTGCACATTTGCAGTGGATGTTGTCTTCATCATAGCTTCATAT
ATGAAGATCTTGGGCACTATTATGAACCTGGAGACTCAAGACAGAAACTGGAAATCACTG
CACACTTGTGCCTGCCACCTGTGCACAGTGCTTGTGTTTTACCTGCCCCTCATCAGCTTG
GCAGTGCTGCATCGTTACAGCCGGGATGCTTCTCCAGTTCTGTATACCACCATGAGTAAT
GCCTACCTCCTCATGACACCACTACTCAACCCTCTTGTCTACAGTGTCAAATCCAGGCAG
ATCCAGGCTGCTCTGCGCAAGCGATTTTGGGTGCAACGTGTCATTGCTGGGGAA


Conceptual translation

MLAFNSTASNWPTFSFIGIPGLEAAHIWISIPFCVLYIMALGGNALLLILVTAEQNLHEP
QFYFLAVLALTDLGLSLSTMPSVLAVFWFDARHIGLDACLTQMFFIHTLSSVESGILVAM
AFDRLVAICAPLNYTRILTHYTVACLSGAAVLRGTTLLAPLPFFLKTFPFCGTNILSHSY
CYYPDMLNLACGDVSFSSAYGLVFVLCTFAVDVVFIIASYMKILGTIMNLETQDRNWKSL
HTCACHLCTVLVFYLPLISLAVLHRYSRDASPVLYTTMSNAYLLMTPLLNPLVYSVKSRQ
IQAALRKRFWVQRVIAGE