Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR51AC5P Olfactory Receptor

Gene Symbol OR51AC5P
Organism Dog
Family 51
Subfamily AC
Pseudo Yes
Location chr21:27896930-27897843 (-)

Sequence information


Nucleotide sequence

CAATTCTATCAGCCCCCCTTCTTCCTTCTTTCAGGAATTCCAGAGCTAGAGGAGTCTCAC
ATCTGGATCTCCATCCCACTGGGCATCATGTACGTAACTTTCATCCTGGGAAACAGCATC
ATTATTCACATAATACCTAAGAATCCCAGCCTTCATGAGCCTCAATATTTGTTCTTATCC
CTATTGGCAGCCACTGACACAGGCACATCAGCATCTATACCAACTACTGTACTTAATATC
TTTCTCTTCAACCACAGAAAGATGGAGTTCCATGGTTGCTTGGCTCCTATGTTCTTCATC
CATATCTTTTCATGGAGTCAGCCATTCTGCTGGCCATGGCTGTTGACCCCTTTATTGCCA
TATGCAATTCACTGCACTACACTGTGGTCCTGACTCAATCCCATGTTAATCAGATGCAAT
TGGCTACTGTGGCTCGAGGAGAGGTGCTGATGGCTTCCTTGCCCATCCTGCTCAAATGGC
TTCCCTTCTGTAAGAACATCATCCTACCCACTCATTCTGCTTCCCCCCTGATATGGAAGC
TTGCTTGTGGGTCCATTCATGTGAACATCACTTACAGGCTGGCACTGGATCTCTGCTCCT
TTGGTGTTGACTCCATCTTTATTGTTCTGTTTTATGTGTTGATCAAGACAGTTTTGGGCA
TTGTTTCTAGGAAAGGACAGCTTAAGACAGTCAACACATGTGTCTCCCTTAATGTCACTG
TCCTCATTTTCTATGTCCCACTTATTGTCTTAATCCTCATCCTCAGAATAGGCAAATACC
ACTCCCCTCTCCCCCATGTCACTATGTCCAACATTTTCCTTTTCCTCACATCTGTCCTCA
ACCATCTAATTTACAGTGTGAAAACAAAACAGATCAGAAGGGCACTATGTAGACTATTTG
TACTTAAGGTGGGA


Conceptual translation

QFYQPPFFLLSGIPELEESHIWISIPLGIMYVTFILGNSIIIHIIPKNPSLHEPQYLFLS
LLAATDTGTSASIPTTVLNIFLFNHRKMEFHGCLAPMFFIHIFSW/SAILLAMAVDPFI
AICNSLHYTVVLTQSHVNQMQLATVARGEVLMASLPILLKWLPFCKNIILPTHSASPLIW
KLACGSIHVNITYRLALDLCSFGVDSIFIVLFYVLIKTVLGIVSRKGQLKTVNTCVSLNV
TVLIFYVPLIVLILILRIGKYHSPLPHVTMSNIFLFLTSVLNHLIYSVKTKQIRRALCRL
FVLKVG