Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR51AG3 Olfactory Receptor

Gene Symbol OR51AG3
Organism Dog
Family 51
Subfamily AG
Pseudo No
Location chr21:27855017-27855961 (-)

Sequence information


Nucleotide sequence

ATGACAATTCTTAACAACAATAATGCCAGCAGCTTCATCTTTATACTGATGGATCTCCCA
GGACTGGAGGCTGCTCATTGCTGGACAGCTATTCCTATCTGCTCTGTCTATGCTCTATCT
TTGCTGGGTAACATCACCATAATGTACATTGTCAAGTCTGTGCCCAGCCTCCACACACCC
ATGTACCTCTTCCTGTCCATGCTTTCAATGGCTGACTTGGGCCTCTCAGCTTCTACACTA
CCTTCAATGGCAGCTGTTTTTCTCCTAGGCCAGAGAAAGGTGGGAGCTGCAACTTGCTTT
ATGCAACTCTTCTTCATCCATACTTTCTCAGTTATTGAATCAGCTGTGCTCTTGGCCATG
GCTTTCGACCGCTGTGTGGCTATCCGAGAGCCCTTACGCTATGCCACCATTCTTACAACC
AAGCGCATTGGTGCCATTGGGCTAGCCATTGTCACCCGTAGTGCTGCTCTCCATCTGCCC
CTTCCTGTGCTCCTTAGAAGACTGCAATTTCAGCCTGTGAATGCTCTGTCTCATTCATAC
TGCGTTCATCCTGATGTTTTAAGGCTAGCCAGTTCTAGCACTCTTGTGAACAGTAGCTTT
GGGCTCTTTGTCATGCTTTCTACACTAGGATTGGATGCTGTACTCATTCTCCTCTCCTAT
GTGCTAATCTTAAGAACAGTATTGAGCATTGCTTCCAACACGGAGCGGCTTAAAACCCTT
AACACCTGCATTTCCCATATCTGTGCTGTATTACTATTTTATACCCCACTGGTCAGCCTG
TCGATGATTCATCGCTTTGGAAAAATGAAGCTACCAGCTCAGGTATATATGCTTCTCTCC
TATCTGCACTTTCTTGTTCCTCCGATGCTCAACCCAATTGTCTACAGTGTGAAAACCAAA
GAGATTCGGGTACGCATTGTAAAGATGCTCCTCCCAAGAAAACAC


Conceptual translation

MTILNNNNASSFIFILMDLPGLEAAHCWTAIPICSVYALSLLGNITIMYIVKSVPSLHTP
MYLFLSMLSMADLGLSASTLPSMAAVFLLGQRKVGAATCFMQLFFIHTFSVIESAVLLAM
AFDRCVAIREPLRYATILTTKRIGAIGLAIVTRSAALHLPLPVLLRRLQFQPVNALSHSY
CVHPDVLRLASSSTLVNSSFGLFVMLSTLGLDAVLILLSYVLILRTVLSIASNTERLKTL
NTCISHICAVLLFYTPLVSLSMIHRFGKMKLPAQVYMLLSYLHFLVPPMLNPIVYSVKTK
EIRVRIVKMLLPRKH