Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR51B11P Olfactory Receptor

Gene Symbol OR51B11P
Organism Dog
Family 51
Subfamily B
Pseudo Yes
Location chr21:28,246,800-28,247,800 (-)
Aliases cOR51B11P

Sequence information


Nucleotide sequence

ATATGGCCCAAAATTAGCACTGCCCCCTTTTTGCTGACTGGGTTCCCAGGTCTGGAGGCT
GCTCATCACTGGATCTCCCCACTTTTCCCCTTCTTTGCAGTCTACATCTCTGTGCTTCTT
GGCAATGGCACTCTCCTCTACCTCATCAAGGACGACCACAGCCTCCATGAACCCATGTAC
TATTTCCTTGTCATGCTGGCAGGTACCGATCTGATGGTGATATTGACTATGATGCCTACT
GTAATGGGCATCTTATGGATGAATCACCGGGAGATGAGCCATGGAGCCTGCTTCCTGCAG
GCTTACTTCATTCATTCTCTTTCCATTGTGGAATCAGATGTCTTGCTTGCCATGGCCTAT
GATCATTTTATTGCCATCCACAATCCTTTGCGATACACTTCCATTCTCACCAATATTCAA
GTGGTAATGTTAGGGATGGGAGCTTTTATGAGGGATTTTATATTCATCATCCCTCTAATC
TTGTATCATTTTTTCATTTCCATATTGCCATTCTAATATTCTCTCCCATGCTTTCTGTCT
TCATCAAGAAGTCATGAAACTGGCCTGTGCTGACATAACTTTCAATAGACCTTACCCTCT
ATTtttttctctttctttctttctttctttctttctttctttctttctttctttctttct
ttctttctttctttcttctttctttctctttctttttttttttTTCCTAGATTCTCTGAT
CATCCTTTTCTCCTATATCCTAATTCTTAAGACTGTCATGGGCATAGCCTTTGGTGAAGA
GAGAACCGAGTCCCTCAATACTTGTATCTCCCACACTGGCTGTGTCCTCATCTTTTATGT
CACTGTGATTGTCATTAATCCATCAGTTTGGGAAGAATGTGCCACCAGTGGTCCACATTA
TAATGAGCTATATCTACTTCCTCTTTCCTCCTTTAACGAATCCTACCATCTATAGCATCA
AGACAAAGCAAATTCAATATGGCATTCTCTGCCTTTTATCCAAAGATCAATTT


Conceptual translation

IWPKISTAPFLLTGFPGLEAAHHWISPLFPFFAVYISVLLGNGTLLYLIKDDHSLHEPMY
YFLVMLAGTDLMVILTMMPTVMGILWMNHREMSHGACFLQAYFIHSLSIVESDVLLAMAY
DHFIAIHNPLRYTSILTNIQVVMLGMG\L*GILYSSSL*SCIIFSFPYCHSNILSHAFC
LHQEVMKLACADITFNRPYPLFFSLSFFLSFFLSFFLSFFLSFFLSSFFLFLFFFFLDSL
IILFSYILILKTVMGIAFGEERTESLNTCISHTGCVLI/LCHCDCH*SISLGR/VPPV
VHIIMSYIYFLFPPLTNPTIYSIKTKQIQYGILCLLSKDQF