Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR51B4P Olfactory Receptor

Gene Symbol OR51B4P
Organism Dog
Family 51
Subfamily B
Pseudo Yes
Location chr21:28,228,200-28,229,100 (-)
Aliases cOR51B4P

Sequence information


Nucleotide sequence

GCTGCTCCCTTCTTGCTAACTGGCTTCCTGGGCTCAGAGGCAATTCACCACTGGATCTCT
ATTCCCTTCTTTATGATCTATTTCTTCATCCTTTTGGGCAATGGCACACTTTTCTTCCTC
ATTTGGAACGACTCCAGCCTTCATGAGCCCATGTACTATTTCCTGGCTATGCTGGCAGGT
ACAGACCTTGGAATGACACTAACTACAATGCCCACAGTCCTGGGTGTCTTATTGCTGGAC
CAGAGGGAAATTTCCCAGGGTGCCTGTTTCACTCAGTCCTACTTCATTCATACCCTGGCC
ATTGTGGAATCGGGTGTGTTGCTTGCCATGGCCTATGACCGATTCATCGCCATCCGCACT
CCTCTGAGGTATAACTCCATTCTTACCAATTCTCGGGTGATGAAGGTAGGACTGGGTGTA
CTAATGAGGGGCTTTATGTCCATTGTGCCCCCAATCATGCCACTCTACTGGTTCCCATAT
TGCCGTTCCCATGTTCTTTCCCATGCCTTTTGCCTCCACCAAGATGTCATGAAACTTGCC
TGTGCTGATATTACATTTAATCGTGTGTACCCAGTCATTCTGGTTGCTTTGACTTTCTTC
CTAGATGCTCTCATTATACTCTTCTCTTATATTTTAATCCTGAAGACAGTTATGGGTATT
GCCTCTAGAGAAGAGAGAGCTAAGGCCCTTAACACCTGTGTCTCACATATTAGCAGTGTC
CTGGTCTTTTATATTACTGTGATTGGCCTGACTTTCATCCACAGGTTTGGGAAGCATGCA
CCACATGTGGTCCACATCACCATGAGCTACGTCTACTTTCTCTTTCCTCCATTCATGAAC
CCCATTATATATAGTATGAAGACCAAGCAAATTCAGAGAGGTTTCATTCGCCTATTT


Conceptual translation

PIT/AAPFLLTGFLGSEAIHHWISIPFFMIYFFILLGNGTLFFLIWNDSSLHEPMYYFL
AMLAGTDLGMTLTTMPTVLGVLLLDQREISQGACFTQSYFIHTLAIVESGVLLAMAYDRF
IAIRTPLRYNSILTNSRVMKVGLGVLMRGFMSIVPPIMPLYWFPYCRSHVLSHAFCLHQD
VMKLACADITFNRVYPVILVALTFFLDALIILFSYILILKTVMGIASREERAKALNTCVS
HISSVLVFYITVIGLTFIHRFGKHAPHVVHITMSYVYFLFPPFMNPIIYSMKTKQIQRGF
IRLF