Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR51C4 Olfactory Receptor

Gene Symbol OR51C4
Organism Dog
Family 51
Subfamily C
Pseudo No
Location chr21:27,089,100-27,090,100 (-)
Aliases cOR51C4

Sequence information


Nucleotide sequence

ATGCCAAACTTCCAGAATACCACATCTACTTCCATCATTTTCCTGCTAACTGGTGTTCCC
GGGCTGGAAGCCTTCCACACCTGGATCTCCATTCCCTTCTGCTTTCTCTACATAACCGCC
CTCTCAGGAAACAGCCTGATCCTCTTTGCCATTGTCACTCAGCCCAGCCTCCACGAACCC
ATGTATTATTTCCTTTCCATGCTGTCTACCACTGACCTCGGCCTATCCATATCCACCCTG
GTCACCATGTTGGGTATATTCTGGTTCAATGCCAGGGAGATCAGCTTTAATGCTTGCTTG
TCACAGATGTTCTTTATTAAACTCTTCACTGTCATGGAATCCTCGGTGCTGTTGGCCATG
GCCTTTGATCGTTTTGTGGCCATCTCTAATCCACTCAGGTATGCCACCATTTTAACCGAT
TCCAGAATAGCTCAAATTGGAGTGACAATTGTCATCAGGGGAACACTAATGCTGACACCA
ATGGTAGCACTTCTTAAAAGACTGTCCTTCTGCCGCAGCCACGTGCTCCACCACTCCTAC
TGCTTCCACCCTGATGTGATGAAGCTCTCGTGCACAGACACCAGGATCAACAATGCAGTT
GGGCTGACAGCCATGATCTCTACTGTTGGTGTGGACTCAATCCTCATCCTCCTTTCTTAC
ATTTTGATTATTAAGACTGTCCTCAGCATTGCATCCCCAGAAGAGAGGAAGAAAGCCTTC
AGCACATGTATCTCCCATATTGGGGCTGTTGCTATTTTCTATTTTCCATTGATCAGTCTG
TCCTTTGTTCACAGATTTGGAAAACGAGCTCCAGCCTATGTTCATACAATGATTGCTAAC
ACTTACCTCTTGATCCCTCCTGTAATGAACCCCATCATCTACAGCGTGAAGACAAAACAG
ATACGCAGAGCTGTGATAAAAATTCTCTATTCCAAAGACATG


Conceptual translation

MPNFQNTTSTSIIFLLTGVPGLEAFHTWISIPFCFLYITALSGNSLILFAIVTQPSLHEP
MYYFLSMLSTTDLGLSISTLVTMLGIFWFNAREISFNACLSQMFFIKLFTVMESSVLLAM
AFDRFVAISNPLRYATILTDSRIAQIGVTIVIRGTLMLTPMVALLKRLSFCRSHVLHHSY
CFHPDVMKLSCTDTRINNAVGLTAMISTVGVDSILILLSYILIIKTVLSIASPEERKKAF
STCISHIGAVAIFYFPLISLSFVHRFGKRAPAYVHTMIANTYLLIPPVMNPIIYSVKTKQ
IRRAVIKILYSKDM