Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR51D1 Olfactory Receptor

Gene Symbol OR51D1
Organism Dog
Family 51
Subfamily D
Pseudo No
Location chr21:27,008,000-27,009,000 (+)
Aliases cOR51D2

Sequence information


Nucleotide sequence

ATGGTGTTTCTCCTTTTCCCCTTCATAGACCCTGGACTTGGCATGCAGAAGCCTCAGCTC
ATGGTTCCTGTCATGGCCACTCCAAATGGAACTCTGGTCCACCCAGCATATTTCCTGCTG
GTGGGCATTCCTGGCCTGGGGCCTAACATACACTTTTGGCTAGCTTTTCCACTGTGTTTT
ATGTATGCCTTGGCCACCCTGGGGAACCTGGCCATTGTCCTTATCATCCGTGTGGAAAGG
CGCCTGCATGAGCCCATGTACCTCTTCCTGGCCATGCTTTCTACCATTGACCTAGTCCTG
TCTTCTGTCACTATGCCCAAGATGGCCAGCCTCTTCCTGACTGGCATCCAGGAGATAGGA
TTCAATGTTTGTCTGGCTCAGATGTTCCTTATCCATGCTCTGTCAGCCATGGAGTCAGCT
GTCCTGCTGGCCATGGCTTTTGACCGCTTTGTGGCCATCTGCCATCCACTGCGGCATGCT
TCTGTGCTCACAGGGCCTACTGTGGCCAAGATTGGACTAGCTGCCCTTACCAGGGGATTT
GTTTTCTTCTTCCCACTGCCCTTCATCCTGAAGCGGTTGTCATATTGCCAAACACATACT
GTCACACACTCCTTCTGTTTGCACCAAGATATTATGAAGTTGTCCTGTACTGATACCATG
GTTAATGTAGTATATGGACTCTTCATTATCCTCTCAGTGATGGGTGTGGACTCCCTCTTC
ATTGGCCTCTCCTACATCCTCATACTGAAGACTGTATTGGATCTGTCTTCTCGGGGCGCA
GCACTCAAGGCTTTTAACACATGCGTCTCCCATCTCTGTGCTGTCCTGGTCTTCTATGTG
CCCCTCATTGGGCTCTCAGTGGTGCACAGGCTGGGGGGTCCTACCTCCATGCTCCATGTG
GTTATGGCTAATATCTATCTTCTGCTACCACCTGTGGTCAATCCTGTTGTCTATGGAGCC
AAGACCAAGGAGATCCGTTCACGGGTCCTCCATATCTTCTCACAGGGTGGTAGG


Conceptual translation

MVFLLFPFIDPGLGMQKPQLMVPVMATPNGTLVHPAYFLLVGIPGLGPNIHFWLAFPLCF
MYALATLGNLAIVLIIRVERRLHEPMYLFLAMLSTIDLVLSSVTMPKMASLFLTGIQEIG
FNVCLAQMFLIHALSAMESAVLLAMAFDRFVAICHPLRHASVLTGPTVAKIGLAALTRGF
VFFFPLPFILKRLSYCQTHTVTHSFCLHQDIMKLSCTDTMVNVVYGLFIILSVMGVDSLF
IGLSYILILKTVLDLSSRGAALKAFNTCVSHLCAVLVFYVPLIGLSVVHRLGGPTSMLHV
VMANIYLLLPPVVNPVVYGAKTKEIRSRVLHIFSQGGR