Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR51E2 Olfactory Receptor

Gene Symbol OR51E2
Organism Dog
Family 51
Subfamily E
Pseudo No
Location chr21:27,080,500-27,081,400 (-)
Aliases cOR51E2

Sequence information


Nucleotide sequence

ATGCCAGCTATGAGTTCCTGCAACTTCACACATACCACCTTTGTACTTATTGGTATCCCA
GGATTAGAAGAAGCCCATTTCTGGATCGGCTTCCCCCTGCTTTCAATGTATGCCGTGGCA
CTATTTGGAAACTGCATCGTTGTCTTCATCGTAAGGACAGAGCGCAGCCTACACGCTCCC
ATGTACCTCTTTCTCTGCATGTTGGCAGCCATTGACTTGGCCTTGTCCACATCCACCATG
CCCAAGATCCTCGCCCTCTTCTGGTTTGATTCCCGGGAGATTACTTTTGATGCCTGCATT
GCCCAGATGTTTTTTATTCATGCTCTTTCAGCTATTGAGTCCACTATCCTGCTGGCCATG
GCCTTTGACCGTTATATAGCCATCTGTCACCCACTGCGCCATGCAGCAGTGCTCAACAAT
ACAGTAACAGCCCAGATTGGCATGGTGGCTGTGGCCCGTGGATCACTCTTCTTTATCCCA
CTGCCTCTGCTCATCAAGCGGCTGGCCTTCTGCCATTCCAATGTGCTGTCACACTCCTAT
TGTGTGCACCAGGATATGATGAAGTTGGCCTATGCAGATACATTGCCCAATGTGATCTAT
GGTCTTACAGCCATTCTGTTGGTTATGGGTGTGGATGTCCTCTTCATCTCCTTGTCCTAT
TTTCTGATTATACGAACAGTTCTACAACTGCCTTCCAAGTCAGAGCGGGCCAAGGCTTTT
GGAACCTGTGTGTCACACATCGGTGTGGTATTAGCCTTCTATGTTCCTCTCATTGGCCTC
TCAGTGGTACACCGTTTTGGAAACAGCCTTGATCCCATTGTGCATGTTCTCATGGGTGAT
GTCTATCTACTTCTGCCTCCTGTGATCAATCCCATCATCTACGGTGCCAAGACCAAACAG
ATCAGAACTCGGGTGCTAGCTATGTTCAAGATCAGCTGTGACAAGGACCCTCAGGCTGTG
GGCAGCAGA


Conceptual translation

MPAMSSCNFTHTTFVLIGIPGLEEAHFWIGFPLLSMYAVALFGNCIVVFIVRTERSLHAP
MYLFLCMLAAIDLALSTSTMPKILALFWFDSREITFDACIAQMFFIHALSAIESTILLAM
AFDRYIAICHPLRHAAVLNNTVTAQIGMVAVARGSLFFIPLPLLIKRLAFCHSNVLSHSY
CVHQDMMKLAYADTLPNVIYGLTAILLVMGVDVLFISLSYFLIIRTVLQLPSKSERAKAF
GTCVSHIGVVLAFYVPLIGLSVVHRFGNSLDPIVHVLMGDVYLLLPPVINPIIYGAKTKQ
IRTRVLAMFKISCDKDPQAVGSR