Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR51F1 Olfactory Receptor

Gene Symbol OR51F1
Organism Dog
Family 51
Subfamily F
Pseudo No
Location chr21:27,108,800-27,109,800 (-)
Aliases cOR51F6

Sequence information


Nucleotide sequence

ATGCTACAAATCCAGGAAAACATGCAGATCTTAAGCAACCTGACATCTAAATTTCCAACC
TTCTTGTTGGCTGGCATTCCTGGCCTAGAATCTGCCCATGTGTGGATCTCTATCCCCTTC
TGTTGTCTCTATACCACTGCCCTCTCCGGGAATAGCATGATCCTGTTTGTCATCATTACC
CAGAAGAGTCTCCATGAGCCCATGTACTATTTTCTCTCCATGCTTTCAGCTGCTGACTTA
GGCTTGACTGTTTCTACAATGTCAACAACATTAAGTATCCTCTGGTTTGATGCAATTGAA
ATCAATCTGGATACCTGCATTATCCAAATGTTTTTTCTTCATGGATTTACCTTCATAGAA
TCTGGGGTGCTGGTGGCTATGGCCTTTGACCGCTATGTGGCCATCTGTGATCCTCTGAGG
TACACTACCCTTCTCACTAATTCTAGAATCATTCAGATGGGCCTGTTAATGACTATACGC
ACTTTAGTATTAGTAGTACCACCACTTTTGCTCCTTAAACCCCTCTATTTCTGTAGAACA
AATGTCCTTTCCCACTCCTACTGCTACCACCCAGATGTGATTAAATTAGCATGTTCAGAT
ACTTGGGCCAATAGCATCTGTGGATTAATTGATCTCATCCTGACAACAGGAATAGATACA
CCATGCATTATCTTGTCTTATATTTTGATCATTCATTCTGTCCTCAGTATTGCCTCCCCT
GAAGAGAGACATAAGGTCTTTAACACTTGTATCTCCCACATTGGAGCAGTGGCTGTTTTC
TATATCCCCATGATGAGCCTGTCTTTGGTTCATCGTTATGGTCCATCAGCACCCAAAATA
GTCCATTCGATGATGGCCAATATATATCTGCTTTTGCCTCCTGTGCTCAACCCCATCATC
TATAGTGTAAAAACAAAACAGATTCGCAAGGCTATATACTCAGTCTTCTCCTTACAAAAT
AAACAGATGATTGCC


Conceptual translation

MLQIQENMQILSNLTSKFPTFLLAGIPGLESAHVWISIPFCCLYTTALSGNSMILFVIIT
QKSLHEPMYYFLSMLSAADLGLTVSTMSTTLSILWFDAIEINLDTCIIQMFFLHGFTFIE
SGVLVAMAFDRYVAICDPLRYTTLLTNSRIIQMGLLMTIRTLVLVVPPLLLLKPLYFCRT
NVLSHSYCYHPDVIKLACSDTWANSICGLIDLILTTGIDTPCIILSYILIIHSVLSIASP
EERHKVFNTCISHIGAVAVFYIPMMSLSLVHRYGPSAPKIVHSMMANIYLLLPPVLNPII
YSVKTKQIRKAIYSVFSLQNKQMIA