Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR51J3 Olfactory Receptor

Gene Symbol OR51J3
Organism Dog
Family 51
Subfamily J
Pseudo No
Location chr21:28,347,100-28,348,100 (+)
Aliases cOR51J3

Sequence information


Nucleotide sequence

ATGAAGAACTCCAATAGTTCTTTGGAGTCTTTACCTACAACTTTCATTCTGGTTGGCATC
CCAGGGCTGGAGGCAGAGCACATTTGGATATCCATCCCCTTCTGCCTGATGTATATTATC
ATCTTCCTTGGGAATGGCACCATTCTTCATGTCATCAGAACAGACCCCGCCTTGCACCAG
CCCATGTACCTCTTTCTTGCCATGTTGGCCCTGGCTGAAGTTGGTGTCTCTGCAACAACT
CTGCCTACAGTTCTAGGCATCTTCCTTTTTGGCACCACTGAGATTAATTTTGATGCCTGC
CTTTTTCAGATGTTCTTCATCCATTCTTTCTCCATTATGGAGTCAGCTGTGTTGCTGGCC
ATGTCTGTGGACCGATTTGTGGCCATCCATAATCCACTGCGCTATACAGCCATCCTCACC
CTGCCCCGTATATTTGGCACAGGAATGATCATGGGGCTGAAAAGCATTATTCTCATGGCC
CCATTACCCATGCTATTAAGGCATCTGCCCTTCTGTGGCCATAATGTCCTTGCACATTCC
TATTGCCTCCACCCCAACCTTATCCATCTACCTTGTGGGGATGTTTCTATCAACAATATC
TATGGGCTTTTCATTGTTACCTCTACTTTTGGGCTGGATTCACTGCTTATTGTGATCTCC
TATCGGCTCATACTCCACACTGTACTGAGTATCACTACTGGGAAGGGGAGGAGGAAGGCA
CTCAACACTTGTGGCTCACATATCTGTGCTGTACTCACTTACTATGTGCCTATGATTGGC
TTATCTATGGTGCATCGCCTTGGATTCCATGTGTCCCCTTTGGTGCACGCTATGATGGCC
AATGCTTATCTCTTCTTCCCACCTGTTGTCAACCCCATTGTCTACAGCATTAAGACCAAA
GAGATCCATTGTGGCATTGTACGAATGCTCTCACAGAAAAAAGCAAGAATT


Conceptual translation

MKNSNSSLESLPTTFILVGIPGLEAEHIWISIPFCLMYIIIFLGNGTILHVIRTDPALHQ
PMYLFLAMLALAEVGVSATTLPTVLGIFLFGTTEINFDACLFQMFFIHSFSIMESAVLLA
MSVDRFVAIHNPLRYTAILTLPRIFGTGMIMGLKSIILMAPLPMLLRHLPFCGHNVLAHS
YCLHPNLIHLPCGDVSINNIYGLFIVTSTFGLDSLLIVISYRLILHTVLSITTGKGRRKA
LNTCGSHICAVLTYYVPMIGLSMVHRLGFHVSPLVHAMMANAYLFFPPVVNPIVYSIKTK
EIHCGIVRMLSQKKARI